Akiyoshi Fukamizu
#155,785
Most Influential Person Now
Researcher
Akiyoshi Fukamizu's AcademicInfluence.com Rankings
Akiyoshi Fukamizucomputer-science Degrees
Computer Science
#8551
World Rank
#8988
Historical Rank
Algorithms
#335
World Rank
#340
Historical Rank
Machine Learning
#3529
World Rank
#3572
Historical Rank
Artificial Intelligence
#3839
World Rank
#3894
Historical Rank

Download Badge
Computer Science
Akiyoshi Fukamizu's Degrees
- PhD Computer Science University of Tokyo
- Masters Computer Science University of Tokyo
- Bachelors Computer Science University of Tokyo
Similar Degrees You Can Earn
Why Is Akiyoshi Fukamizu Influential?
(Suggest an Edit or Addition)Akiyoshi Fukamizu's Published Works
Number of citations in a given year to any of this author's works
Total number of citations to an author for the works they published in a given year. This highlights publication of the most important work(s) by the author
Published Works
- Angiotensin-converting enzyme 2 protects from severe acute lung failure (2005) (2239)
- Mice lacking the vitamin D receptor exhibit impaired bone formation, uterine hypoplasia and growth retardation after weaning (1997) (1107)
- ACE2 links amino acid malnutrition to microbial ecology and intestinal inflammation (2012) (965)
- Mechanical stress activates angiotensin II type 1 receptor without the involvement of angiotensin II (2004) (643)
- Silent information regulator 2 potentiates Foxo1-mediated transcription through its deacetylase activity. (2004) (598)
- Insulin-induced phosphorylation of FKHR (Foxo1) targets to proteasomal degradation (2003) (521)
- Adipose angiotensinogen is involved in adipose tissue growth and blood pressure regulation (2001) (501)
- Acetylation of Foxo1 alters its DNA-binding ability and sensitivity to phosphorylation. (2005) (457)
- Two domains of Nrf2 cooperatively bind CBP, a CREB binding protein, and synergistically activate transcription (2001) (439)
- Regulatory Roles for APJ, a Seven-transmembrane Receptor Related to Angiotensin-type 1 Receptor in Blood Pressure in Vivo* (2004) (399)
- Arginine methylation of FOXO transcription factors inhibits their phosphorylation by Akt. (2008) (395)
- Identification and functional analysis of endothelial tip cell-enriched genes. (2010) (376)
- Angiotensinogen-deficient mice with hypotension. (1994) (375)
- Angiotensin II Type 1a Receptor-deficient Mice with Hypotension and Hyperreninemia (*) (1995) (372)
- Epigenetic Control of rDNA Loci in Response to Intracellular Energy Status (2008) (369)
- Bile Acids Regulate Gluconeogenic Gene Expression via Small Heterodimer Partner-mediated Repression of Hepatocyte Nuclear Factor 4 and Foxo1* (2004) (322)
- SREBPs suppress IRS-2-mediated insulin signalling in the liver (2004) (309)
- The sphingosine-1-phosphate transporter Spns2 expressed on endothelial cells regulates lymphocyte trafficking in mice. (2012) (282)
- The Signal-Dependent Coactivator CBP Is a Nuclear Target for pp90RSK (1996) (279)
- Regulation of PGC-1 promoter activity by protein kinase B and the forkhead transcription factor FKHR. (2003) (279)
- Chimeric renin-angiotensin system demonstrates sustained increase in blood pressure of transgenic mice carrying both human renin and human angiotensinogen genes. (1993) (261)
- Regulation of FoxO transcription factors by acetylation and protein-protein interactions. (2011) (259)
- Hypertension Induced in Pregnant Mice by Placental Renin and Maternal Angiotensinogen (1996) (253)
- Urinary excretion of fatty acid-binding protein reflects stress overload on the proximal tubules. (2004) (215)
- Mitogen-activated protein kinases, Erk and p38, phosphorylate and regulate Foxo1. (2007) (214)
- Role of Deltex-1 as a Transcriptional Regulator Downstream of the Notch Receptor* (2001) (206)
- Renin inhibition reduces hypercholesterolemia-induced atherosclerosis in mice. (2008) (205)
- Cytoplasmic destruction of p53 by the endoplasmic reticulum‐resident ubiquitin ligase ‘Synoviolin’ (2007) (199)
- Synoviolin/Hrd1, an E3 ubiquitin ligase, as a novel pathogenic factor for arthropathy. (2003) (196)
- Angiotensinogen-Deficient Mice Exhibit Impairment of Diet-Induced Weight Gain with Alteration in Adipose Tissue Development and Increased Locomotor Activity. (2001) (189)
- Calcium signaling through CaMKII regulates hepatic glucose production in fasting and obesity. (2012) (172)
- Attenuation of diet-induced weight gain and adiposity through increased energy expenditure in mice lacking angiotensin II type 1a receptor. (2005) (169)
- Insulin-like Growth Factor 1/Insulin Signaling Activates Androgen Signaling through Direct Interactions of Foxo1 with Androgen Receptor* (2007) (162)
- Renin-dependent Cardiovascular Functions and Renin-independent Blood-Brain Barrier Functions Revealed by Renin-deficient Mice* (2000) (155)
- Apelin is a positive regulator of ACE2 in failing hearts. (2013) (151)
- Activation and maturation mechanisms of boar acrosin zymogen based on the deduced primary structure. (1989) (151)
- Activation of Renin‐Angiotensin System Induces Osteoporosis Independently of Hypertension (2009) (150)
- High human renin hypertension in transgenic rats. (1997) (146)
- Angiotensin type 1a receptor signaling-dependent induction of vascular endothelial growth factor in stroma is relevant to tumor-associated angiogenesis and tumor growth. (2004) (145)
- Smad3 is acetylated by p300/CBP to regulate its transactivation activity (2007) (144)
- Angiotensin II plays a pathogenic role in immune-mediated renal injury in mice. (1999) (144)
- Benfotiamine Counteracts Glucose Toxicity Effects on Endothelial Progenitor Cell Differentiation via Akt/FoxO Signaling (2006) (136)
- Structure and expression of the human angiotensinogen gene. Identification of a unique and highly active promoter. (1990) (136)
- (Pro)renin Receptor–Mediated Signal Transduction and Tissue Renin-Angiotensin System Contribute to Diabetes-Induced Retinal Inflammation (2009) (131)
- Endothelin-1 regulates cardiac sympathetic innervation in the rodent heart by controlling nerve growth factor expression. (2004) (129)
- Requirement of apelin-apelin receptor system for oxidative stress-linked atherosclerosis. (2007) (128)
- Negative regulation of forkhead transcription factor AFX (Foxo4) by CBP-induced acetylation. (2003) (128)
- Regulation of Lef-mediated Transcription and p53-dependent Pathway by Associating β-Catenin with CBP/p300* (2000) (124)
- The LXXLL motif of murine forkhead transcription factor FoxO1 mediates Sirt1-dependent transcriptional activity. (2006) (124)
- Transient decrease in high blood pressure by in vivo transfer of antisense oligodeoxynucleotides against rat angiotensinogen. (1995) (121)
- Impaired blood–brain barrier function in angiotensinogen-deficient mice (1998) (120)
- S1P(2), the G protein-coupled receptor for sphingosine-1-phosphate, negatively regulates tumor angiogenesis and tumor growth in vivo in mice. (2010) (119)
- Arginine methylation of BCL-2 antagonist of cell death (BAD) counteracts its phosphorylation and inactivation by Akt (2011) (119)
- A Combination of HNF-4 and Foxo1 Is Required for Reciprocal Transcriptional Regulation of Glucokinase and Glucose-6-phosphatase Genes in Response to Fasting and Feeding* (2008) (114)
- Enhanced erythropoiesis mediated by activation of the renin‐angiotensin system via angiotensin II type 1a receptor (2005) (113)
- Nucleotide sequence of the unique nitrate/nitrite-inducible cytochrome P-450 cDNA from Fusarium oxysporum. (1991) (111)
- Distinct neural mechanisms for the control of thirst and salt appetite in the subfornical organ (2016) (107)
- Nephrogenesis and renovascular development in angiotensinogen-deficient mice. (1996) (105)
- Tissue-specific expression of the human renin gene in transgenic mice. (1989) (105)
- Estrogen Regulates Tumor Growth Through a Nonclassical Pathway that Includes the Transcription Factors ERβ and KLF5 (2011) (105)
- Functional association between CBP and HNF4 in trans-activation. (1997) (103)
- Cooperative Interaction of EWS with CREB-binding Protein Selectively Activates Hepatocyte Nuclear Factor 4-mediated Transcription* (2003) (103)
- A Role of RNA Helicase A in cis-Acting Transactivation Response Element-mediated Transcriptional Regulation of Human Immunodeficiency Virus Type 1* (2001) (102)
- Dual Roles of RNA Helicase A in CREB-Dependent Transcription (2001) (100)
- Hepatocyte Nuclear Factor-4 Is a Novel Downstream Target of Insulin via FKHR as a Signal-regulated Transcriptional Inhibitor* (2003) (98)
- Identification of a novel isoform of poly(A) polymerase, TPAP, specifically present in the cytoplasm of spermatogenic cells. (2000) (97)
- ELABELA-APJ axis protects from pressure overload heart failure and angiotensin II-induced cardiac damage (2017) (96)
- Essential Role of Synoviolin in Embryogenesis* (2005) (96)
- FOXO transcription factors in the regulatory networks of longevity. (2007) (94)
- Characterization of RGS5 in regulation of G protein-coupled receptor signaling. (2001) (94)
- Angiotensinogen, angiotensin II and adipose tissue development (2000) (93)
- Activation of two angiotensin‐generating systems in the balloon‐injured artery (1993) (92)
- Guanylyl Cyclase-A Inhibits Angiotensin II Type 1A Receptor-Mediated Cardiac Remodeling, an Endogenous Protective Mechanism in the Heart (2002) (90)
- A cis-Acting DNA Element Located between TATA Box and Transcription Initiation Site Is Critical in Response to Regulatory Sequences in Human Angiotensinogen Gene* (1996) (88)
- Nrf2 Improves Leptin and Insulin Resistance Provoked by Hypothalamic Oxidative Stress. (2017) (87)
- Structure of the rat renin gene. (1988) (86)
- Central nervous system‐specific deletion of transcription factor Nrf1 causes progressive motor neuronal dysfunction (2011) (85)
- Nrf2 Neh5 domain is differentially utilized in the transactivation of cytoprotective genes. (2007) (85)
- Genetic deficiency of angiotensinogen produces an impaired urine concentrating ability in mice. (1998) (83)
- Detection of LacZ-Positive Cells in Living Tissue with Single-Cell Resolution. (2016) (83)
- Apelin Stimulates Myosin Light Chain Phosphorylation in Vascular Smooth Muscle Cells (2006) (83)
- Pathophysiology of placentation abnormalities in pregnancy-induced hypertension (2008) (78)
- Foxo1 links insulin signaling to C/EBPα and regulates gluconeogenesis during liver development (2007) (78)
- Foxo1 increases pro-inflammatory gene expression by inducing C/EBPbeta in TNF-alpha-treated adipocytes. (2009) (77)
- Androgen contributes to gender-related cardiac hypertrophy and fibrosis in mice lacking the gene encoding guanylyl cyclase-A. (2004) (74)
- Activation of angiotensin II‐forming chymase in the cardiomyopathic hamster heart (1997) (74)
- Phosphatidylinositol 3-Kinase/Akt Regulates Angiotensin II–Induced Inhibition of Apoptosis in Microvascular Endothelial Cells by Governing Survivin Expression and Suppression of Caspase-3 Activity (2004) (73)
- Structure of the human renin gene. (1984) (72)
- Asymmetric arginine dimethylation determines life span in C. elegans by regulating forkhead transcription factor DAF-16. (2011) (72)
- Angiopoietin-1 Induces Krüppel-like Factor 2 Expression through a Phosphoinositide 3-Kinase/AKT-dependent Activation of Myocyte Enhancer Factor 2*♦ (2009) (71)
- Ileal Bile Acid-binding Protein, Functionally Associated with the Farnesoid X Receptor or the Ileal Bile Acid Transporter, Regulates Bile Acid Activity in the Small Intestine* (2005) (71)
- Salt-sensitive aortic aneurysm and rupture in hypertensive transgenic mice that overproduce angiotensin II. (1998) (71)
- Expression of the human angiotensinogen gene in transgenic mice and transfected cells. (1991) (66)
- The neuronal isoform of constitutive nitric oxide synthase is up-regulated in the macula densa of angiotensinogen gene-knockout mice. (1997) (66)
- Saccharomyces cerevisiae CWH43 is involved in the remodeling of the lipid moiety of GPI anchors to ceramides. (2007) (65)
- The presence of both the amino- and carboxyl-terminal domains in the AR is essential for the completion of a transcriptionally active form with coactivators and intranuclear compartmentalization common to the steroid hormone receptors: a three-dimensional imaging study. (2002) (64)
- Acceleration of atherosclerotic lesions in transgenic mice with hypertension by the activated renin-angiotensin system. (1997) (64)
- Transcriptional down-regulation through nuclear exclusion of EWS methylated by PRMT1. (2005) (64)
- NML-mediated rRNA base methylation links ribosomal subunit formation to cell proliferation in a p53-dependent manner (2016) (64)
- APJ Regulates Parallel Alignment of Arteries and Veins in the Skin. (2015) (61)
- Antithetic Effects of MBD2a on Gene Regulation (2003) (61)
- Lung Surfactant Levels are Regulated by Ig-Hepta/GPR116 by Monitoring Surfactant Protein D (2013) (60)
- Regulation of FOXO1-mediated transcription and cell proliferation by PARP-1. (2009) (60)
- Rodent α‐chymases are elastase‐like proteases (2002) (59)
- (Pro)renin receptor promotes choroidal neovascularization by activating its signal transduction and tissue renin-angiotensin system. (2008) (58)
- Physiological function of the angiotensin AT1a receptor in bone remodeling (2011) (57)
- Role of Notch-1 intracellular domain in activation of rheumatoid synoviocytes. (2001) (57)
- Severe Hypomyelination and Developmental Defects Are Caused in Mice Lacking Protein Arginine Methyltransferase 1 (PRMT1) in the Central Nervous System* (2015) (56)
- Human activin betaA gene. Identification of novel 5' exon, functional promoter, and enhancers. (1996) (56)
- Identification of renin and renin messenger RNA sequence in rat ovary and uterus. (1987) (56)
- Expression of neuronal type nitric oxide synthase and renin in the juxtaglomerular apparatus of angiotensin type-1a receptor gene-knockout mice. (1998) (56)
- Nrf2 inactivation enhances placental angiogenesis in a preeclampsia mouse model and improves maternal and fetal outcomes (2017) (54)
- Comparative studies on species-specific reactivity between renin and angiotensinogen (1994) (53)
- Evaluation of novel cyclic analogues of apelin. (2008) (52)
- Neurochondrin Negatively Regulates CaMKII Phosphorylation, and Nervous System-specific Gene Disruption Results in Epileptic Seizure* (2005) (52)
- Human β-Globin Locus Control Region HS5Contains CTCF- and Developmental Stage-Dependent Enhancer-BlockingActivity in ErythroidCells (2003) (51)
- RGS domain in the amino-terminus of G protein-coupled receptor kinase 2 inhibits Gq-mediated signaling. (2000) (50)
- An essential role for angiotensin II Type 1a receptor in pregnancy‐associated hypertension with intrauterine growth retardation (2004) (49)
- Stretch-induced MAP kinase activation in cardiomyocytes of angiotensinogen-deficient mice. (1997) (48)
- Induction of apoptosis in vitro and in vivo by H-1 parvovirus infection. (1998) (47)
- Anti-apoptotic action of angiotensin fragments to neuronal cells from angiotensinogen knock-out mice (1997) (47)
- Recent advances in the study of renin and angiotensinogen genes: from molecules to the whole body. (1995) (46)
- Role of Natriuretic Peptide Receptor Guanylyl Cyclase-A in Myocardial Infarction Evaluated Using Genetically Engineered Mice (2005) (46)
- Identification of cell type-dependent enhancer core element located in the 3'-downstream region of the human angiotensinogen gene. (1994) (46)
- A role for endothelial cells in promoting the maturation of astrocytes through the apelin/APJ system in mice (2012) (45)
- Molecular mechanism of transcriptional activation of angiotensinogen gene by proximal promoter. (1994) (45)
- EWS is a substrate of type I protein arginine methyltransferase, PRMT8. (2008) (43)
- Reduced angiogenesis and delay in wound healing in angiotensin II type 1a receptor-deficient mice. (2009) (43)
- Reduction of depressive-like behavior in mice lacking angiotensinogen (1999) (43)
- Rodent alpha-chymases are elastase-like proteases. (2003) (42)
- Protein arginine methyltransferase 7 has a novel homodimer‐like structure formed by tandem repeats (2014) (42)
- Human renin in transgenic mouse kidney is localized to juxtaglomerular cells. (1991) (41)
- The nuclear import of RNA helicase A is mediated by importin-α3 (2006) (41)
- Reduced hypertension-induced end-organ damage in mice lacking cardiac and renal angiotensinogen synthesis (2002) (41)
- Loss of Apela Peptide in Mice Causes Low Penetrance Embryonic Lethality and Defects in Early Mesodermal Derivatives. (2017) (40)
- Molecular characterization of Mybbp1a as a co-repressor on the Period2 promoter (2008) (39)
- Species Differences in Angiotensin II Generation and Degradation by Mast Cell Chymases (2005) (39)
- Ovarian renin gene expression is regulated by follicle-stimulating hormone. (1987) (38)
- Regulated Expression of Human Angiotensinogen Gene by Hepatocyte Nuclear Factor 4 and Chicken Ovalbumin Upstream Promoter-Transcription Factor* (1999) (38)
- Nitric oxide reductase cytochrome P-450 gene, CYP 55, of the fungus Fusarium oxysporum containing a potential binding-site for FNR, the transcription factor involved in the regulation of anaerobic growth of Escherichia coli. (1994) (37)
- Adult Stage γ-Globin Silencing Is Mediated by a Promoter Direct Repeat Element (2005) (37)
- Mechanism of cAMP regulation of renin gene transcription by proximal promoter. (1994) (37)
- Male sterility in transgenic mice expressing activin betaA subunit gene in testis. (1999) (37)
- Inhibitory Effect of the Small Heterodimer Partner on Hepatocyte Nuclear Factor-4 Mediates Bile Acid-induced Repression of the Human Angiotensinogen Gene* (2004) (36)
- Learning and anxiety in angiotensin-deficient mice (1999) (35)
- Angiotensin II type 1A receptor signaling facilitates tumor metastasis formation through P-selectin-mediated interaction of tumor cells with platelets and endothelial cells. (2013) (35)
- PRMT8 as a phospholipase regulates Purkinje cell dendritic arborization and motor coordination (2015) (35)
- Nutrient control of phosphorylation and translocation of Foxo1 in C57BL/6 and db/db mice. (2006) (34)
- Deterioration of atherosclerosis in mice lacking angiotensin II type 1A receptor in bone marrow-derived cells (2008) (34)
- G protein-coupled APJ receptor signaling induces focal adhesion formation and cell motility. (2005) (34)
- Impaired placental neovascularization in mice with pregnancy-associated hypertension (2008) (34)
- Unique pH dynamics in GABAergic synaptic vesicles illuminates the mechanism and kinetics of GABA loading (2016) (34)
- Podocyte injury-driven lipid peroxidation accelerates the infiltration of glomerular foam cells in focal segmental glomerulosclerosis. (2015) (34)
- Effects of high-fat diet, angiotensinogen (agt) gene inactivation, and targeted expression to adipose tissue on lipid metabolism and renal gene expression. (2002) (33)
- Idiopathic portal hypertension associated with progressive systemic sclerosis. (1982) (33)
- Transgene-derived hepatocyte growth factor attenuates reactive renal fibrosis in aristolochic acid nephrotoxicity. (2003) (33)
- Molecular characterization of the zinc finger transcription factor, Osterix. (2006) (32)
- Genomic imprinting recapitulated in the human β-globin locus (2005) (32)
- The nuclear import of RNA helicase A is mediated by importin-alpha3. (2006) (32)
- A Randomly Integrated Transgenic H19 Imprinting Control Region Acquires Methylation Imprinting Independently of Its Establishment in Germ Cells (2009) (32)
- Cloning of the gene and cDNA for hamster chymase 2, and expression of chymase 1, chymase 2 and angiotensin-converting enzyme in the terminal stage of cardiomyopathic hearts. (1998) (32)
- Isolation of novel cell-penetrating peptides from a random peptide library using in vitro virus and their modifications. (2009) (32)
- Proximal and core DNA elements are required for efficient angiotensinogen promoter activation during adipogenic differentiation. (1993) (32)
- NFkappaB2 (p52) promoter activation via Notch signaling pathway in rheumatoid synoviocytes. (2001) (31)
- Identification of a previously unrecognized production site of human renin. (1991) (31)
- Regulation of alkaline phosphatase promoter activity by forkhead transcription factor FKHR. (2002) (31)
- GSK3β regulates gluconeogenic gene expression through HNF4α and FOXO1 (2012) (31)
- Mechanism for p38α-mediated Experimental Autoimmune Encephalomyelitis* (2012) (31)
- Rescue of angiotensinogen-knockout mice. (1998) (31)
- Apelin elevates blood pressure in ICR mice with L-NAME-induced endothelial dysfunction (2013) (31)
- Identification of a Crucial Site for Synoviolin Expression (2005) (31)
- Hypernuclear acetylation in atherosclerotic lesions and activated vascular smooth muscle cells. (1999) (30)
- A combination of upstream and proximal elements is required for efficient expression of the mouse renin promoter in cultured cells. (1992) (29)
- Differential roles of renin and angiotensinogen in the feto-maternal interface in the development of complications of pregnancy. (2005) (29)
- The Drosophila Zinc Finger Transcription Factor Ouija Board Controls Ecdysteroid Biosynthesis through Specific Regulation of spookier (2015) (29)
- Renin expression in the kidney and brain is reciprocally controlled by captopril. (1989) (27)
- Characterization and identification of promoter elements in the mouse COX17 gene. (2002) (27)
- Induction of hydroxyapatite resorptive activity in bone marrow cell populations resistant to bafilomycin A1 by a factor with restricted expression to bone and brain, neurochondrin. (1999) (27)
- Structure and sequence analysis of the human activin beta A subunit gene. (1991) (27)
- Pregnancy-associated homeostasis and dysregulation: lessons from genetically modified animal models. (2011) (27)
- Genomic imprinting recapitulated in the human beta-globin locus. (2005) (26)
- Dietary salt loading decreases the expressions of neuronal-type nitric oxide synthase and renin in the juxtaglomerular apparatus of angiotensinogen gene-knockout mice. (1998) (26)
- Molecular mechanism of adipogenic activation of the angiotensinogen gene. (1994) (26)
- Structure and expression of the mouse angiotensinogen gene. (1992) (25)
- Nucleotide sequence of rat renin cDNA. (1988) (25)
- Adult stage gamma-globin silencing is mediated by a promoter direct repeat element. (2005) (25)
- R127W-HNF-4α is a loss of function mutation but not a rare polymorphism and causes Type II diabetes in a Japanese family with MODY1 (2000) (25)
- Inhibitory effects of benzyl benzoate and its derivatives on angiotensin II-induced hypertension. (2008) (24)
- CRM1 mediates nuclear export of nonstructural protein 2 from parvovirus minute virus of mice. (1999) (24)
- Possible roles of the 3'-flanking sequences of the human activin beta A subunit gene in its expression. (1993) (24)
- A cell type-dependent enhancer core element is located in exon 5 of the human angiotensinogen gene. (1994) (24)
- Endothelin-1 expression in hearts of transgenic hypertensive mice overexpressing angiotensin II. (1998) (24)
- Mitocryptide-2, a neutrophil-activating cryptide, is a specific endogenous agonist for formyl-peptide receptor-like 1. (2011) (23)
- Sox-Oct motifs contribute to maintenance of the unmethylated H19 ICR in YAC transgenic mice. (2013) (23)
- An Essential Role of Angiotensin II Receptor Type 1a in Recipient Kidney, Not in Transplanted Peripheral Blood Leukocytes, in Progressive Immune-Mediated Renal Injury (2001) (22)
- Single-cell nanobiopsy reveals compartmentalization of mRNAs within neuronal cells (2018) (22)
- CTCF binding is not the epigenetic mark that establishes post-fertilization methylation imprinting in the transgenic H19 ICR. (2010) (22)
- Finb, a multiple zinc finger protein, represses transcription of the human angiotensinogen gene. (2004) (22)
- De novo DNA methylation through the 5′-segment of the H19 ICR maintains its imprint during early embryogenesis (2015) (22)
- Targeted disruption of the neurochondrin/norbin gene results in embryonic lethality. (2003) (21)
- Ground-based assessment of JAXA mouse habitat cage unit by mouse phenotypic studies (2016) (21)
- Calreticulin and integrin alpha dissociation induces anti-inflammatory programming in animal models of inflammatory bowel disease (2018) (21)
- A selective requirement for copper-dependent activation of cytochrome c oxidase by Cox17p. (2004) (21)
- Human renin gene of renin-secreting tumor. (1986) (20)
- Production of free methylarginines via the proteasome and autophagy pathways in cultured cells. (2011) (20)
- Bile acid represses the peroxisome proliferator-activated receptor-gamma coactivator-1 promoter activity in a small heterodimer partner-dependent manner. (2007) (20)
- Late-onset obesity in mice transgenic for the human renin gene. (2003) (20)
- Alterations in renal endothelial nitric oxide synthase expression by salt diet in angiotensin type-1a receptor gene knockout mice. (2004) (19)
- Oxidative stress-induced ubiquitination of RCAN1 mediated by SCFbeta-TrCP ubiquitin ligase. (2008) (19)
- Pathologic characterization of hypotensive C57BL/6J-agt: angiotensinogen-deficient C57BL/6J mice. (1998) (19)
- Cloning and characterization of a novel splicing isoform of USF1. (2003) (19)
- Dimerization of small GTPase Rab5. (2001) (19)
- Relevance of nuclear localization and functions of RNA helicase A. (2005) (19)
- PRMT1 Deficiency in Mouse Juvenile Heart Induces Dilated Cardiomyopathy and Reveals Cryptic Alternative Splicing Products (2018) (19)
- A single nucleotide mutation in the mouse renin promoter disrupts blood pressure regulation. (2008) (19)
- Novel helical assembly in arginine methyltransferase 8. (2016) (18)
- Angiotensin Type 1 Receptor Blockade Prevents Cardiac Remodeling in Mice with Pregnancy-Associated Hypertension (2008) (18)
- Sequencing and expression of sheep angiotensinogen cDNA. (1994) (18)
- Possible Role of Transcriptional Coactivator P/CAF and Nuclear Acetylation in Calcium-induced Keratinocyte Differentiation* (2002) (18)
- Effect of genetic deficiency of angiotensinogen on the renin-angiotensin system. (1998) (17)
- Angiotensinogen gene-activating elements regulate blood pressure in the brain. (1999) (17)
- KDM5D-mediated H3K4 demethylation is required for sexually dimorphic gene expression in mouse embryonic fibroblasts (2019) (17)
- Vascular remodeling in hypertensive transgenic mice. (1999) (16)
- pH-Dependent structural changes at Ca(2+)-binding sites of coagulation factor IX-binding protein. (2005) (16)
- Cell type-dependent transactivation or repression of mesoderm-restricted basic helix-loop-helix protein, POD-1/Capsulin (2000) (16)
- Regulation of activin beta A mRNA level by cAMP. (1992) (16)
- Molecular characterization of mesoderm-restricted basic helix-loop-helix protein, POD-1/Capsulin. (2000) (15)
- The C. elegans PRMT-3 possesses a type III protein arginine methyltransferase activity (2011) (15)
- Possible involvement of p38 mitogen-activated protein kinase in decidual function in parturition. (2001) (15)
- Isolation and identification of novel neutrophil-activating cryptides hidden in mitochondrial cytochrome C. (2012) (15)
- Possible involvement of downregulation of the apelin-APJ system in doxorubicin-induced cardiotoxicity. (2015) (15)
- The human renin gene in transgenic mice. (1990) (15)
- Angiotensin II regulates liver regeneration via type 1 receptor following partial hepatectomy in mice. (2008) (15)
- PCAF represses transactivation function of FOXO1 in an acetyltransferase-independent manner (2010) (15)
- Significant role of the increase in renin-angiotensin system in cardiac hypertrophy and renal glomerular sclerosis in double transgenic tsukuba hypertensive mice carrying both human renin and angiotensinogen genes. (1998) (15)
- Molecular cloning and expression of human neurochondrin-1 and -2. (1999) (14)
- Species-specific kinetics of mouse renin contribute to maintenance of normal blood pressure in transgenic mice with overexpressed human angiotensinogen. (1992) (14)
- Effects of interaction between parvovirus minute virus of mice NS1 and coactivator CBP on NS1- and p53-transactivation. (2001) (14)
- m6A‐mediated alternative splicing coupled with nonsense‐mediated mRNA decay regulates SAM synthetase homeostasis (2021) (13)
- Emerging impacts of biological methylation on genetic information. (2018) (13)
- p38 Mitogen-activated protein kinase accelerates emphysema in mouse model of chronic obstructive pulmonary disease (2014) (13)
- Highly conserved Drosophila ananassae timeless gene functions as a clock component in Drosophila melanogaster. (2003) (13)
- Cell type-specific expression of the human renin gene. (1991) (13)
- Morphological and northern blot analysis of juxtaglomerular cells in experimental hydronephrotic mice (1992) (13)
- Identification of cis-Regulatory Sequences in the Human Angiotensinogen Gene by Transgene Coplacement and Site-Specific Recombination (2005) (13)
- Erythropoiesis and Blood Pressure Are Regulated via AT1 Receptor by Distinctive Pathways (2015) (13)
- Expression and characterization of mouse angiotensin II type 1a receptor tagging hemagglutinin epitope in cultured cells. (1999) (13)
- Increased cardiac angiotensin II receptors in angiotensinogen-deficient mice. (1998) (13)
- Roles of protein arginine methyltransferase 1 (PRMT1) in brain development and disease. (2020) (13)
- Expression of the human angiotensinogen gene in human cell lines. (1990) (12)
- The H19 Imprinting Control Region Mediates Preimplantation Imprinted Methylation of Nearby Sequences in Yeast Artificial Chromosome Transgenic Mice (2012) (12)
- A case of renin producing leiomyosarcoma originating in the lung. (1991) (12)
- Age-dependent decline in remyelination capacity is mediated by apelin–APJ signaling (2021) (12)
- rRNA adenine methylation requires T07A9.8 gene as rram-1 in Caenorhabditis elegans (2018) (12)
- Identification of N-terminal minimal transactivation domain of CBP, p300 and caenorhabditis elegans homologues. (1998) (12)
- Aromatic residues are required for RNA helicase A mediated transactivation. (2003) (12)
- Comparative study of renin expression in the coagulating glands of C57BL/6 and Balb/c mice. (1992) (11)
- Renin gene expression in the adrenal and kidney of patients with primary aldosteronism. (1992) (11)
- TNFalpha induces acetylation of p53 but attenuates its transcriptional activation in rheumatoid synoviocytes. (2002) (11)
- Angiodysplasia in embryo lacking protein arginine methyltransferase 1 in vascular endothelial cells. (2016) (10)
- Genetic disruption of angiotensin II type 1a receptor improves long-term survival of mice with chronic severe aortic regurgitation. (2007) (10)
- Transcriptomic changes involved in the dedifferentiation of myofibroblasts derived from the lung of a patient with idiopathic pulmonary fibrosis (2020) (10)
- Asymmetric Arginine Dimethylation Modulates Mitochondrial Energy Metabolism and Homeostasis in Caenorhabditis elegans (2016) (10)
- Truncated Cables1 causes agenesis of the corpus callosum in mice (2014) (10)
- Ectopic production of renin by ileal carcinoma. (1989) (10)
- Histamine receptor agonist alleviates severe cardiorenal damages by eliciting anti-inflammatory programming (2020) (10)
- Sleep/Wake Behaviors in Mice During Pregnancy and Pregnancy-Associated Hypertensive Mice (2018) (10)
- Biochemical characteristics of human renin expressed in transgenic mice. (1993) (10)
- Cooperative action of APJ and α1A-adrenergic receptor in vascular smooth muscle cells induces vasoconstriction. (2019) (10)
- Simultaneous ablation of prmt-1 and prmt-5 abolishes asymmetric and symmetric arginine dimethylations in Caenorhabditis elegans (2017) (10)
- New aspects of the renin-angiotensin system in blood pressure regulation (1995) (10)
- Activation of mouse renin promoter by cAMP and c-Jun in a kidney-derived cell line. (1993) (10)
- Expressions of Cytochrome P450, UDP-Glucuronosyltranferase, and Transporter Genes in Monolayer Carcinoma Cells Change in Subcutaneous Tumors Grown As Xenografts in Immunodeficient Nude Mice (2010) (9)
- Activation of the Nuclear Oncogenes N-myc and c-jun in Cartinoid Tumors of Transgenic Mice Carrying the Human Adenovirus Type 12 E1 Region Gene (1995) (9)
- Partial purification and characterization of proteinases from abdomen part muscle of antarctic krill (1986) (9)
- Angiotensinogen-deficient mice exhibit impairment of diet-induced weight gain with alteration in adipose tissue development and increased locomotor activity. (2001) (9)
- Effect of peroxisome proliferator-activated receptor α on human angiotensinogen promoter (2004) (9)
- Possible roles of the transcription factor Nrf1 (NFE2L1) in neural homeostasis by regulating the gene expression of deubiquitinating enzymes. (2017) (9)
- A nuclear receptor, hepatocyte nuclear factor 4, differently contributes to the human and mouse angiotensinogen promoter activities (2010) (9)
- Enhanced histamine production through the induction of histidine decarboxylase expression by phorbol ester in Jurkat cells (2012) (9)
- Synthetic DNA fragments bearing ICR cis elements become differentially methylated and recapitulate genomic imprinting in transgenic mice (2018) (9)
- The endothelin receptor antagonist ameliorates the hypertensive phenotypes of transgenic hypertensive mice with renin-angiotensin genes and discloses roles of organ specific activation of endothelin system in transgenic mice. (2004) (9)
- Identification of a novel nucleolar protein complex required for mitotic chromosome segregation through centromeric accumulation of Aurora B (2020) (9)
- Isolation and characterization of 5′‐regulatory region of mouse activin ßa subunit gene (1998) (8)
- Effect of lactation on postpartum cardiac function of pregnancy-associated hypertensive mice. (2013) (8)
- Use of Transgenic Animals in the Study of Neuropeptide Genes (1993) (8)
- Short-term suppression of the renin-angiotensin system in mice associated with hypertension during pregnancy. (2012) (8)
- Possible role of c-Jun in transcription of the mouse renin gene. (1998) (8)
- A Novel Proximal Element Mediates the Regulation of Mouse Ren-1C Promoter by Retinoblastoma Protein in Cultured Cells* (1997) (8)
- Nontranscriptional Function of FOXO1/DAF-16 Contributes to Translesion DNA Synthesis (2016) (8)
- Tricarboxylic acid cycle activity suppresses acetylation of mitochondrial proteins during early embryonic development in Caenorhabditis elegans (2019) (8)
- Expression of the fungal cytochrome P-450nor cDNA in Escherichia coli. (1993) (8)
- Lactation Is a Risk Factor of Postpartum Heart Failure in Mice with Cardiomyocyte-specific Apelin Receptor (APJ) Overexpression* (2016) (8)
- Speedy backcrossing through in vitro fertilization, using pre-pubertal superovulation and neonatal death dependent on genetic background in angiotensinogen-deficient mice. (1997) (8)
- Nucleomethylin deficiency impairs embryonic erythropoiesis (2018) (7)
- Linear Distance from the Locus Control Region Determines ε-Globin Transcriptional Activity (2007) (7)
- Transcriptomic Evaluation of Pulmonary Fibrosis-Related Genes: Utilization of Transgenic Mice with Modifying p38 Signal in the Lungs (2020) (7)
- Sialic acid residue of ovine angiotensinogen does not affect the reactivity to human renin (2000) (7)
- Deficiency of Cardiac Natriuretic Peptide Signaling Promotes Peripartum Cardiomyopathy-Like Remodeling in the Mouse Heart (2020) (7)
- Evaluation of coculture aggregation with TT2 cells for production of germline chimera. (1995) (7)
- Expression of Cyclooxygenase-2 in the Juxtaglomerular Apparatus of Angiotensinogen Gene-Knockout Mice (2004) (7)
- Antithetic Effects of MBD 2 a on Gene Regulation (2003) (7)
- Transgenic and knockout models in renin-angiotensin system. (1999) (7)
- Structure of an RNA duplex r(GGCGBrUGCGCU)2 with terminal and internal tandem G.U base pairs. (2006) (6)
- PRMT-5 converts monomethylarginines into symmetrical dimethylarginines in Caenorhabditis elegans (2017) (6)
- Tissue-specific trans-activation of renin gene by targeted expression of adenovirus E1A in transgenic mice. (1994) (6)
- Neuroectodermal tumors expressing c-, L-, and N-myc in transgenic mice that carry the E1A/E1B gene of human adenovirus type 12. (1994) (6)
- Cytoplasmic destruction of p 53 by the endoplasmic reticulum-resident ubiquitin ligase ‘ (2013) (6)
- Effect of peroxisome proliferator-activated receptor alpha on human angiotensinogen promoter. (2004) (6)
- Genomic expression systems on hierarchy and network leading to hypertension: long on history, short on facts. (2000) (6)
- Regulation of human renin and angiotensinogen genes. (1991) (6)
- Activation of the nuclear oncogenes N-myc and c-jun in carcinoid [correction of cartinoid] tumors of transgenic mice carrying the human adenovirus type 12 E1 region gene. (1995) (6)
- Conserved SAMS function in regulating egg-laying in C. elegans (2013) (6)
- ATF-like element contributes to hepatic activation of human angiotensinogen promoter. (1997) (6)
- Species-specific induction of angiotensinogen mRNA in transgenic mouse liver during acute phase reaction. (1992) (6)
- Angiotensin II accelerates mammary gland development independently of high blood pressure in pregnancy-associated hypertensive mice (2015) (6)
- Molecular Properties of Recombinant Ovine Angiotensinogen (2000) (6)
- Production of transgenic rats using pregnant and pseudopregnant rats prepared at a breeding farm. (1993) (6)
- Detection of Coagulating Gland Renin by Hybridohistochemistry (1996) (6)
- Detection of choline and phosphatidic acid (PA) catalyzed by phospholipase D (PLD) using MALDI-QIT-TOF/MS with 9-aminoacridine matrix (2014) (5)
- Species-specific expression of the hepatic renin gene. (1994) (5)
- All of the human β‐type globin genes compete for LCR enhancer activity in embryonic erythroid cells of yeast artificial chromosome transgenic mice (2009) (5)
- Linear distance from the locus control region determines epsilon-globin transcriptional activity. (2007) (5)
- Mutation analysis of HNF-4 binding sites in the human glucose-6-phosphatase promoter. (2005) (5)
- Developmental stage-specific involvement of angiotensin in murine nephrogenesis (1999) (5)
- Hypertensive and hypotensive mice produced by the introduction and disruption of genes on the renin-angiotensin system. (1996) (5)
- Cortical expression of the human angiotensinogen gene in the kidney of transgenic mice. (1994) (5)
- Transcriptional regulation of energy metabolism in the liver (2010) (5)
- DNase I Hypersensitivity and ϵ-Globin Transcriptional Enhancement Are Separable in Locus Control Region (LCR) HS1 Mutant Human β-Globin YAC Transgenic Mice* (2010) (5)
- Role of Kenae/CCDC125 in cell motility through the deregulation of RhoGTPase. (2009) (5)
- Inoculation of Human Tumor Cells Alters the Basal Expression but Not the Inducibility of Cytochrome P450 Enzymes in Tumor-Bearing Mouse Liver (2009) (4)
- Combinatorial action of cAMP and phorbol ester on synergistic expression of the human activin A gene. (1994) (4)
- Identification of the mouse neurochondrin promoter region and the responsible region for cell type specific gene regulation (2004) (4)
- Expression and characterization of recombinant rat angiotensinogen derived from Chinese hamster ovary cells (1992) (4)
- Region-specific upregulation of HNK-1 glycan in the PRMT1-deficient brain. (2019) (4)
- A mouse renin distal enhancer is essential for blood pressure homeostasis in BAC-rescued renin-null mutant mice (2014) (4)
- SPECIES DIFFERENCES IN BINDING OF SUBMANDIBULAR NUCLEAR PROTEINS TO RENIN PROMOTER DNA (1993) (3)
- Structural organization of the mouse neurochondrin gene. (2004) (3)
- Heritable formation of neuroectodermal tumor in transgenic mice carrying the combined e1 region gene of adenovirus type 12 with the deregulated human renin promoter (1995) (3)
- Synoviolin as a novel pathogenic factor for arthropathy (2003) (3)
- Transgenic animals in endocrinological investigation (1993) (3)
- Isolation of the Mouse Ren-1C Gene and Characterization of Renin Gene Expression in Both ES-D3 Cells and Their Parental Mouse Strain (1993) (3)
- Loss of PRMT1 in the central nervous system (CNS) induces reactive astrocytes and microglia during postnatal brain development (2020) (3)
- The Chicken HS4 Insulator Element Does Not Protect the H19 ICR from Differential DNA Methylation in Yeast Artificial Chromosome Transgenic Mouse (2013) (3)
- Effects of aging and uninephrectomy on renal changes in Tsukuba hypertensive mice. (2013) (3)
- Embryonic Intra-Aortic Clusters Undergo Myeloid Differentiation Mediated by Mesonephros-Derived CSF1 in Mouse (2016) (3)
- Activated and inactivated renin-angiotensin system in transgenic animals: from genes to blood pressure. (1997) (3)
- siRNA screening identifies METTL9 as a histidine Nπ-methyltransferase that targets the proinflammatory protein S100A9 (2021) (3)
- Kinetic studies on recombinant human renin with recombinant human angiotensinogen derived from Chinese hamster ovary cells (1992) (3)
- Human Activin βA Gene IDENTIFICATION OF NOVEL 5′ (1996) (2)
- Gestational changes in PRMT1 expression of murine placentas. (2018) (2)
- Generation and characterization of new monoclonal antibodies against human chymase. (2004) (2)
- Tsukuba Hypertensive Mice (1993) (2)
- Pterosin B has multiple targets in gluconeogenic programs, including coenzyme Q in RORα-SRC2 signaling. (2016) (2)
- Novel method for selection of tRNA-driven ribozymes with enhanced stability in mammalian cells. (2002) (2)
- Detection of ethanolamine altering in fetuses of pregnancy-associated hypertensive mice treated with vasodepressors by using UPLC and MALDI-TOF/MS. (2015) (2)
- [Angiotensin II and apoptosis]. (1999) (2)
- Disruption of entire Cables2 locus leads to embryonic lethality by diminished Rps21 gene expression and enhanced p53 pathway (2020) (2)
- Temporal transcriptomic profiling reveals dynamic changes in gene expression of Xenopus animal cap upon activin treatment (2021) (2)
- Endothelial Natriuretic Peptide Receptor 1 Play Crucial Role for Acute and Chronic Blood Pressure Regulation by Atrial Natriuretic Peptide (2022) (2)
- The molecular and neural regulation of ultraviolet light phototaxis and its food-associated learning behavioral plasticity in C. elegans (2021) (2)
- Homeostatic Response of Mouse renin Gene Transcription in a Hypertensive Environment Is Mediated by a Novel 5′ Enhancer (2018) (2)
- PRMT-5 converts monomethylarginines into symmetrical dimethylarginines in Caenorhabditis elegans. (2018) (2)
- Pathophysiological Roles of Renin-Angiotensin System on Erythropoietic Action (2006) (2)
- Rat renin promoter activity in cultured cells and transgenic mice. (1993) (1)
- Isolation and characterization of 5'-regulatory region of mouse activin beta A subunit gene. (1998) (1)
- C. ELEGANS MEETS DATA SONIFICATION: CAN WE HEAR ITS ELEGANT MOVEMENT? (2011) (1)
- Cytodifferentiation Enhances Erk Activation Induced by Endothelin-1 in Primary Cultured Astrocytes (2004) (1)
- Long-Range Control of Renin Gene Expression in Tsukuba Hypertensive Mice (2016) (1)
- Hydralazine is involved in tele-methylhistamine metabolism by inhibiting monoamine oxidase B in pregnancy-associated hypertensive mice. (2017) (1)
- Cables2 Is a Novel Smad2-Regulatory Factor Essential for Early Embryonic Development in Mice (2019) (1)
- CTF18 interacts with replication protein A in response to replication stress. (2016) (1)
- Tsukuba Hypertensive Mice Transgenic Mice Carrying both Human Renin and Human Angiotensinogen Genes.:Transgenic Mice Carrying both Human Renin and Human Angiotensinogen Genes (1993) (1)
- 5922A novel APJ ligand, ELABELA/Apela/Toddler, protects from pressure overload- and Angiotensin II-induced cardiac hypertrophy and fibrosis (2017) (1)
- [A role of angiotensin II found in knockout mice with angiotensin signal breakdown]. (2000) (1)
- Transvection-like interchromosomal interaction is not observed at the transcriptional level when tested in the Rosa26 locus in mouse (2019) (1)
- Sequences in the H19 ICR that are transcribed as small RNA in oocytes are dispensable for methylation imprinting in YAC transgenic mice. (2012) (1)
- [Genetic dissection of the renin-angiotensin system]. (2005) (0)
- Increased angiotensin II coupled with decreased Adra1a expression enhances cardiac hypertrophy in pregnancy-associated hypertensive mice (2023) (0)
- Role of Renin-Anglotensin System in Cardiac Remodeling after Aortic Regurgitation in Mice (2003) (0)
- Lactic acid Amino acid Muscle Muscle Neuron Heart Kidney Red blood cell Red blood cell Adipocyte Liver Glucose (2010) (0)
- Genomic Expression Systems on Hierarchy Network Leading to Hypertension : Long on History , Short on Facts and (2006) (0)
- Hypertension-responsive enhancer regulates the renin gene transcription (2016) (0)
- (Pro)renin Receptor Promotes Choroidal Neovascularization by Dually Activating Its Signal Transduction and Tissue Renin-Angiotensin System (2008) (0)
- [Transgenic models for human hypertension]. (2000) (0)
- Novel Neutrophil-Activating Cryptides Hidden in Mitochondrial Cytochrome c : Identification and Structure-Activity Studies (2012) (0)
- 1P-0154 Angiotensin II plays as a survival factor in the retinal endothelial cells through type 1 receptor and PI 3-kinase-Akt pathway (2003) (0)
- Ferric chloride induces irreversible pulmonary fibrosis in mice (2020) (0)
- Distal element regulates hypertension-responsiveness of the mouse renin gene (2015) (0)
- [Regulation of cellular functions by arginine methylation]. (2009) (0)
- Comparative study ofrenin expression inthecoagulating glands ofC57BL/6andBalbfc mice (1992) (0)
- Synthetic DNA fragments bearing ICR cis elements become differentially methylated and recapitulate genomic imprinting in transgenic mice (2018) (0)
- No evidence for transvection in vivo by a superenhancer:promoter pair integrated into identical open chromatin at the Rosa26 locus (2018) (0)
- 1068 Endothelin-1 Level in the hypertrophied heart of Tsukuba Hypertensive Mice (1996) (0)
- In vivo imaging to visualize feto-maternal interface in pregnancy-associated hypertension mouse (2019) (0)
- 25. Tsukuba Hypertensive Mice Transgenic Mice Carrying both Human Renin and Human Angiotensinogen Genes (2006) (0)
- Regulation of neural stem cell proliferation and survival by protein arginine methyltransferase 1 (2022) (0)
- Endothelin-1 Disruption Decreases Cardiac Sympathetic Innervation by Downregulation of Nerve Growth Factor (2003) (0)
- Linear distance from the LCR determines the transciptional activity of ε-globin in human β-globin YAC transgenic mice (2007) (0)
- siRNA screening identi fi es METTL9 as a histidine N π -methyltransferase that targets the proin fl ammatory protein S100A9 (2021) (0)
- Homologous recombination of mouse ZAKI-4 gene to disrupt its expression (2002) (0)
- A NIQSDIGASENSDGDM VVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEG SCISGFQGMNLPTESGELWILGNVFIRQYFTVFDRANNQVGLAPVA bChy L NIQQAIGATQNQYGEF DIDCDNLSYMPTVVFEINGKMYPLTPSAYTSQDQG FCTSGFQSEN HS QKWILGDVFIREYYSVFDRANNLVGLAKAI Pen SQYYSQVSGAQQDSNAGGYVFDCSSS LPDFSVSISGYTATVPGSLINYGPSGDG STCLGGIQSNSG IG FSIFGDIFLKSQYVVFD (0)
- [Developmental biotechnology and hypertension--emphasis on renin-angiotensin system]. (1993) (0)
- [Angiotensin and arteriosclerosis: an approach from transgenic and knockout mice]. (1999) (0)
- The importance of Synoviolin in embryogenesis (2003) (0)
- Roles of PRMT8 with dual catalytic activity in the brain (2017) (0)
- Identification and Structure-Activity Studies of Novel Cryptides Hidden in Mitochondrial Proteins (2013) (0)
- Apelin-APJ System Plays an Important Role in Preventing Catecholamine-induced Cardiac Hypertrophy (2008) (0)
- Translocation of RNA helicase A and its implication on gene expression (1998) (0)
- Histochemical analysis of copper chaperone proteins - Cox17p, Sco1p and Sco2p - in different regions of the mouse brain (特集 微量元素研究 up-to-date) -- (Neurological Diseases and Trace Elements) (2003) (0)
- [Functional role of angiotensin II predicted from the phenotypes of transgenic and knockout mice]. (1998) (0)
- Calreticulin and integrin alpha dissociation induces anti-inflammatory programming in animal models of inflammatory bowel disease (2018) (0)
- A mechanism for the establishment and maintenance of methylation imprinting by the H19 ICR in human beta-globin YAC TgM (2007) (0)
- , Activating Elements Regulate Blood Pressure in the Brain − Angiotensinogen Gene (1999) (0)
- Expression of oncogenes and angiotensinogen gene in human ileal renin-secreting carcinoma (1992) (0)
- [New codified regulation of arginine methylation and Akt-induced phosphorylation]. (2010) (0)
- [Genetic dissection of protease and signal transduction network]. (1997) (0)
- Acetylation of an Ets Transcription Factor PU.1 Suppresses Its Transcriptional Activity. (2007) (0)
- Effects of PRMT1 splice variants on biological functions (2017) (0)
- [Genetically engineered mice for study of human hypertension]. (1997) (0)
- Apelin expression is downregulated in T cells in a murine model of chronic colitis. (2023) (0)
- The N-terminal sequence of murine PRMT5 variant 2 is required for Hsp70 interaction and CHIP ligase-mediated degradation. (2019) (0)
- [Transcriptional regulation of RAAS genes--in vivo analysis by artificial chromosome transgenic mouse]. (2012) (0)
- Ischemia-driven exosome release of human iPSC-CM-derived cardiomyocytes increase viability of endothelial cells via pro-survival factors BENCH Dipeptidyl peptidase-4 inhibitor markedly enhances the cardioprotective efficacy of Sodium-glucose cotransporter-2 inhibitor in pre-diabetic rats with cardiac (0)
- Pathophysiology of hypertensive transgenic mice carrying the human renin and angiotensinogen genes (1994) (0)
- Humanrenin intransgenic mouse kidney islocalized to juxtaglomerular cells (1991) (0)
- Regulation of p53-dependent cell proliferation through rRNA base methylation (2016) (0)
- Thursday May 29, Bayview A and B, 5:00 pm Theme I: Genetic and Molecular Models in Cardiovascular Disease: Hypertension in pregnant mice (1997) (0)
- Transgenic Mice and Knock Out Mice in Hypertension Research (1996) (0)
- Human renin derived from the transgenic fetal placenta is secreted into the plasma of pregnant mice (1994) (0)
- Remodelling and cardioprotection 1247 (0)
- Anti-inflammatory programing of histamine H3 receptor on the pathology in a mouse model of cardio-renal association (2017) (0)
- Apelin/apj Signaling Regulates Retinal Vascular Remodeling via Interaction Between Endothelial Cells and Astrocytes (2010) (0)
- [FOXO: the regulator of metabolism, longevity, and aging]. (2005) (0)
- Crystal Structure of Habu IX-bp at pH 6.5 (2005) (0)
- Cryptides : Non-Classical Bioactive Peptides Hidden in Protein Structures (2011) (0)
- Generation of Transgenic Mice with Human Renin and Angiotensinogen Genes (1991) (0)
- NML-mediated rRNA base methylation regulates cell proliferation through the p53 pathway (2016) (0)
- 0107 Enhanced Endothelin Pathway Is Involved in the Development of Cardiac Hypertrophy in the Mouse Transgenically Activated Renin-Angiotensin System (1997) (0)
- Inoculation of human tumor cells alters the basal expression but not the inducibility of Cyp enzymes in tumor-bearing mouse liver (2009) (0)
- [A new paradigm for renin research]. (2005) (0)
- Regulation of Ovarian Renin Gene Expression by Follicle Stimulationg Hormone and Estrogen (1987) (0)
- Angiotensin II Plays as a Survival Factor in the Retinal Endotherial Cells Through Type 1 Receptor and PI 3-kinase-akt Pathway (2003) (0)
- [Genetic dissection of the renin-angiotensin system]. (2006) (0)
- Tissue and Cellular Localization of Mouse Cox17p Gene-Related Peptide (2000) (0)
- Chymase-dependent angiotensin II formation causes mild hypertension and cardiac hypertrophy (2002) (0)
- Hyper-ERAD: a novel pathomechanism for rheumatoid arthritis (2004) (0)
- Transcriptome analysis of bleomycin-induced pulmonary fibrosis in transgenic mice with modifying p38 signal in the lungs: exploration of the novel therapeutic targets for idiopathic pulmonary fibrosis (2021) (0)
- in tumor-bearing mouse liver (2009) (0)
- Transgenic Hypertensive Animals Carrying Genes for the Components of the Renin-Angiotensin System (1994) (0)
- O45-7 - ELABELA, a Novel APJ Ligand, Inhibits Pressure Overload- and Angiotensin II-induced Cardiac Remodeling (2017) (0)
- Identification of a novel thermo-sensor that acts transactivation of DAF-16 (2017) (0)
- Enhancement in myocardial endothelin-1 pathway contributes to progression of cardiac hypertrophy in the transgenic hypertensive mice overexpressing angiotensin II (1998) (0)
- GCIP, Id like HLH protein, negatively regulates cell proliferation of rheumatoid synovial cells via interaction with CBP (2012) (0)
- Antihypertensive and antihypertrophic effects of chymase inhibitor in human chymase transgenic mice (2002) (0)
- Orientation of mouse H19 ICR affects imprinted H19 gene expression through promoter methylation-dependent and -independent mechanisms (2021) (0)
- PS-B05-2: ANALYSIS OF SHORT-TERM CARDIOVASCULAR AND RENAL DISORDERS IN MICE WITH CARDIO-RENAL DAMAGES (2023) (0)
- Embryonic Intra-Aortic Clusters Undergo Myeloid Differentiation Mediated by Mesonephros-Derived CSF1 in Mouse (2016) (0)
- MP271HISTAMINE IS INVOLVED IN THE PATHOPHYSIOLOGY OF HEART AND KIDNEY DYSFUNCTIONS IN MICE (2016) (0)
- Erratum: Distinct neural mechanisms for the control of thirst and salt appetite in the subfornical organ (2017) (0)
- Identification of two distinct Sp1- and RBF-1-like nuclear factors that bind to the upstream region of the human angiotensinogen promoter (1995) (0)
- DNAse I hypersensitivity and ε -globin transcriptional enhancement are separable in LCR HS1 mutant human β -globin YAC transgenic mice (2010) (0)
- The GATA transcription factor ELT-2 modulates both the expression and methyltransferase activity of PRMT-1 in Caenorhabditis elegans (2018) (0)
- Analysis of phosphoethanolamine methyltransferase-1 as a major consumer of S-adenosylmethionine in Caenorhabditis elegans (2016) (0)
- Analysis of MEFs from PRMT1 splicing variant-2 deficient mice for cellular functions (2016) (0)
- S1P2, the G protein-coupled receptor for sphingosine-1-phosphate, negatively regulates tumor angiogenesis and tumor growth in (2010) (0)
- Rapid Communication Cooperative action of APJ and a1A-adrenergic receptor in vascular smooth muscle cells induces vasoconstriction (2019) (0)
- Genomic / genetic / proteomic : the added value to arthritis research and treatment 1 Osteoarthritis : degeneration of matrix or cells ? (2015) (0)
- Effects of anti-hypertensive drugs on maternal hemolysis in pregnancy-associated hypertensive mice (2017) (0)
- Crystal Structure of Apo-Habu IX-bp at pH 4.6 (2005) (0)
- [Molecular biology and genetics of angiotensin signal-transduction system]. (1997) (0)
This paper list is powered by the following services:
What Schools Are Affiliated With Akiyoshi Fukamizu?
Akiyoshi Fukamizu is affiliated with the following schools: