Dennis Burton

Q: What Schools Are Affiliated With Dennis Burton

Dennis Burton is affiliated with the following schools: University of Sheffield, University College London, University of California, San Diego, Rockefeller University, Massachusetts Institute of Technology, University of Birmingham, University of Copenhagen, Columbia University, Università Cattolica del Sacro Cuore, University of Pennsylvania

Dennis Burton 's AcademicInfluence.com Rankings

Dennis Burton

Biology

#3260

World Rank

#5006

Historical Rank

Microbiology

#96

World Rank

#118

Historical Rank

Immunology

#134

World Rank

#141

Historical Rank

biology Degrees

Download Badge

Biology

Why Is Dennis Burton Influential?

(Suggest an Edit or Addition)

According to Wikipedia, Dennis R. Burton is a professor of immunology and microbiology at the Scripps Research Institute in La Jolla, California, in the United States. He also works in AIDS vaccine research, and is scientific director of the IAVI Neutralizing Antibody Center there. He sits on the steering committee of the Ragon Institute of Massachusetts General Hospital, MIT and Harvard.

(See a Problem?)

Dennis Burton 's Published Works

Number of citations in a given year to any of this author's works

Total number of citations to an author for the works they published in a given year. This highlights publication of the most important work(s) by the author

Published Works

Complete Replication of Hepatitis C Virus in Cell Culture (2005) (2366)
Robust hepatitis C virus infection in vitro. (2005) (1828)
Broad and Potent Neutralizing Antibodies from an African Donor Reveal a New HIV-1 Vaccine Target (2009) (1734)
Broad neutralization coverage of HIV by multiple highly potent antibodies (2011) (1428)
Efficient neutralization of primary isolates of HIV-1 by a recombinant human monoclonal antibody. (1994) (1170)
Isolation of potent SARS-CoV-2 neutralizing antibodies and protection from disease in a small animal model (2020) (1132)
Sequence and Structural Convergence of Broad and Potent HIV Antibodies That Mimic CD4 Binding (2011) (1073)
Printed covalent glycan array for ligand profiling of diverse glycan binding proteins. (2004) (1019)
HIV-1 evades antibody-mediated neutralization through conformational masking of receptor-binding sites (2002) (924)
Fc receptor but not complement binding is important in antibody protection against HIV (2007) (876)
Crystal Structure of a Neutralizing Human IgG Against HIV-1: A Template for Vaccine Design (2001) (875)
Broadly Neutralizing Antibodies Targeted to the Membrane-Proximal External Region of Human Immunodeficiency Virus Type 1 Glycoprotein gp41 (2001) (849)
HIV vaccine design and the neutralizing antibody problem (2004) (835)
Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9 (2011) (827)
Structural definition of a conserved neutralization epitope on HIV-1 gp120 (2007) (822)
Crystal Structure of a Soluble Cleaved HIV-1 Envelope Trimer (2013) (810)
Generation of a large combinatorial library of the immunoglobulin repertoire in phage lambda. (1989) (761)
Comprehensive Cross-Clade Neutralization Analysis of a Panel of Anti-Human Immunodeficiency Virus Type 1 Monoclonal Antibodies (2004) (757)
Antibody Domain Exchange Is an Immunological Solution to Carbohydrate Cluster Recognition (2003) (745)
Focused Evolution of HIV-1 Neutralizing Antibodies Revealed by Structures and Deep Sequencing (2011) (730)
Multiplex PCR method for MinION and Illumina sequencing of Zika and other virus genomes directly from clinical samples (2017) (729)
Antibody Protects Macaques against Vaginal Challenge with a Pathogenic R5 Simian/Human Immunodeficiency Virus at Serum Levels Giving Complete Neutralization In Vitro (2001) (724)
The Broadly Neutralizing Anti-Human Immunodeficiency Virus Type 1 Antibody 2G12 Recognizes a Cluster of α1→2 Mannose Residues on the Outer Face of gp120 (2002) (700)
A large array of human monoclonal antibodies to type 1 human immunodeficiency virus from combinatorial libraries of asymptomatic seropositive individuals. (1991) (692)
A Potent and Broad Neutralizing Antibody Recognizes and Penetrates the HIV Glycan Shield (2011) (691)
Cryo-EM Structure of a Fully Glycosylated Soluble Cleaved HIV-1 Envelope Trimer (2013) (678)
Structure of the Ebola virus glycoprotein bound to an antibody from a human survivor (2008) (664)
Antibodies, viruses and vaccines (2002) (638)
Therapeutic Efficacy of Potent Neutralizing HIV-1-Specific Monoclonal Antibodies in SHIV-Infected Rhesus Monkeys (2013) (610)
Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge (2008) (594)
Human Immunodeficiency Virus Type 1 Elite Neutralizers: Individuals with Broad and Potent Neutralizing Activity Identified by Using a High-Throughput Neutralization Assay together with an Analytical Selection Algorithm (2009) (579)
Effective, low-titer antibody protection against low-dose repeated mucosal SHIV challenge in macaques (2009) (576)
Complement Is Activated by IgG Hexamers Assembled at the Cell Surface (2014) (553)
Broadly Neutralizing Human Anti-HIV Antibody 2G12 Is Effective in Protection against Mucosal SHIV Challenge Even at Low Serum Neutralizing Titers (2009) (529)
Antibodies inhibit prion propagation and clear cell cultures of prion infectivity (2001) (519)
Cross-clade neutralization of primary isolates of human immunodeficiency virus type 1 by human monoclonal antibodies and tetrameric CD4-IgG (1995) (513)
Carbohydrate vaccines: developing sweet solutions to sticky situations? (2010) (502)
Prevention of virus transmission to macaque monkeys by a vaginally applied monoclonal antibody to HIV-1 gp120 (2003) (500)
GP120: target for neutralizing HIV-1 antibodies. (2006) (485)
Recognition properties of a panel of human recombinant Fab fragments to the CD4 binding site of gp120 that show differing abilities to neutralize human immunodeficiency virus type 1 (1994) (483)
Neutralizing antibodies generated during natural HIV-1 infection: good news for an HIV-1 vaccine? (2009) (476)
Ablation of the prion protein (PrP) gene in mice prevents scrapie and facilitates production of anti-PrP antibodies. (1993) (470)
Broadly neutralizing anti-HIV antibody 4E10 recognizes a helical conformation of a highly conserved fusion-associated motif in gp41. (2005) (469)
HIV-1 neutralizing antibodies induced by native-like envelope trimers (2015) (467)
Broad neutralization of SARS-related viruses by human monoclonal antibodies (2020) (464)
Structural basis of a shared antibody response to SARS-CoV-2 (2020) (460)
Highly potent HIV-specific antibody neutralization in vitro translates into effective protection against mucosal SHIV challenge in vivo (2012) (454)
Primary isolates of human immunodeficiency virus type 1 are relatively resistant to neutralization by monoclonal antibodies to gp120, and their neutralization is not predicted by studies with monomeric gp120 (1995) (442)
Broadly Neutralizing Antibodies to HIV and Their Role in Vaccine Design. (2016) (438)
Conformational dynamics of single HIV-1 envelope trimers on the surface of native virions (2014) (413)
Immunoglobulin G: functional sites. (1985) (408)
Broadly Neutralizing Antibodies Present New Prospects to Counter Highly Antigenically Diverse Viruses (2012) (407)
A genetically humanized mouse model for hepatitis C virus infection (2011) (394)
Access of Antibody Molecules to the Conserved Coreceptor Binding Site on Glycoprotein gp120 Is Sterically Restricted on Primary Human Immunodeficiency Virus Type 1 (2003) (384)
The challenges of eliciting neutralizing antibodies to HIV-1 and to influenza virus (2008) (381)
Toward an AIDS Vaccine (2008) (378)
Human antibody–Fc receptor interactions illuminated by crystal structures (2004) (373)
Antibody responses to envelope glycoproteins in HIV-1 infection (2015) (373)
A Blueprint for HIV Vaccine Discovery. (2012) (372)
A Limited Number of Antibody Specificities Mediate Broad and Potent Serum Neutralization in Selected HIV-1 Infected Individuals (2010) (368)
Hepatitis C Virus E2 Envelope Glycoprotein Core Structure (2013) (359)
Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B, and G (2016) (355)
Broadly neutralizing HIV antibodies define a glycan-dependent epitope on the prefusion conformation of gp41 on cleaved envelope trimers. (2014) (350)
Nature of Nonfunctional Envelope Proteins on the Surface of Human Immunodeficiency Virus Type 1 (2006) (349)
Broadly Neutralizing Monoclonal Antibodies 2F5 and 4E10 Directed against the Human Immunodeficiency Virus Type 1 gp41 Membrane-Proximal External Region Protect against Mucosal Challenge by Simian-Human Immunodeficiency Virus SHIVBa-L (2009) (348)
A conformational transition at the N terminus of the prion protein features in formation of the scrapie isoform. (1997) (343)
CDR walking mutagenesis for the affinity maturation of a potent human anti-HIV-1 antibody into the picomolar range. (1995) (342)
HIV-1 broadly neutralizing antibody precursor B cells revealed by germline-targeting immunogen (2016) (333)
A robust, high-throughput assay to determine the phagocytic activity of clinical antibody samples. (2010) (332)
Structural delineation of a quaternary, cleavage-dependent epitope at the gp41-gp120 interface on intact HIV-1 Env trimers. (2014) (329)
Supersite of immune vulnerability on the glycosylated face of HIV-1 envelope glycoprotein gp120 (2013) (329)
Priming a broadly neutralizing antibody response to HIV-1 using a germline-targeting immunogen (2015) (327)
Antibody vs. HIV in a clash of evolutionary titans. (2005) (323)
Envelope glycans of immunodeficiency virions are almost entirely oligomannose antigens (2010) (320)
Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus (2012) (318)
Multidonor analysis reveals structural elements, genetic determinants, and maturation pathway for HIV-1 neutralization by VRC01-class antibodies. (2013) (308)
Structural Basis of Immune Evasion at the Site of CD4 Attachment on HIV-1 gp120 (2009) (307)
Recombinant HIV envelope trimer selects for quaternary-dependent antibodies targeting the trimer apex (2014) (304)
Commonality despite exceptional diversity in the baseline human antibody repertoire (2018) (304)
Nonhuman primate models and the failure of the Merck HIV-1 vaccine in humans (2008) (303)
Passive transfer of modest titers of potent and broadly neutralizing anti-HIV monoclonal antibodies block SHIV infection in macaques (2014) (297)
HIV Vaccine Design to Target Germline Precursors of Glycan-Dependent Broadly Neutralizing Antibodies (2016) (292)
Localization of the binding site for the human high-affinity Fc receptor on IgG (1988) (291)
Anti-Human Immunodeficiency Virus Type 1 (HIV-1) Antibodies 2F5 and 4E10 Require Surprisingly Few Crucial Residues in the Membrane-Proximal External Region of Glycoprotein gp41 To Neutralize HIV-1 (2005) (290)
Ebola Virus Can Be Effectively Neutralized by Antibody Produced in Natural Human Infection (1999) (289)
The neutralizing antibody response to HIV-1: viral evasion and escape from humoral immunity. (1999) (286)
Broadly Neutralizing Antibody PGT121 Allosterically Modulates CD4 Binding via Recognition of the HIV-1 gp120 V3 Base and Multiple Surrounding Glycans (2013) (283)
Passive immunization with a human monoclonal antibody protects hu-PBL-SCID mice against challenge by primary isolates of HIV-1 (1997) (282)
Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12. (2005) (281)
Fine Mapping of the Interaction of Neutralizing and Nonneutralizing Monoclonal Antibodies with the CD4 Binding Site of Human Immunodeficiency Virus Type 1 gp120 (2003) (271)
The antiviral activity of antibodies in vitro and in vivo (2001) (268)
Vaccine-Induced Cellular Immune Responses Reduce Plasma Viral Concentrations after Repeated Low-Dose Challenge with Pathogenic Simian Immunodeficiency Virus SIVmac239 (2006) (268)
Limited or no protection by weakly or nonneutralizing antibodies against vaginal SHIV challenge of macaques compared with a strongly neutralizing antibody (2011) (267)
Structural basis for diverse N-glycan recognition by HIV-1–neutralizing V1–V2–directed antibody PG16 (2013) (267)
Recent progress in broadly neutralizing antibodies to HIV (2018) (266)
gp120: Biologic aspects of structural features. (2001) (266)
Neutralizing antibodies have limited effects on the control of established HIV-1 infection in vivo. (1999) (266)
Human antibody effector function. (1992) (263)
HIV vaccine design: insights from live attenuated SIV vaccines (2005) (263)
Targeting the carbohydrates on HIV-1: Interaction of oligomannose dendrons with human monoclonal antibody 2G12 and DC-SIGN (2008) (262)
Fusion peptide of HIV-1 as a site of vulnerability to neutralizing antibody (2016) (260)
Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors (2015) (260)
AAV-expressed eCD4-Ig provides durable protection from multiple SHIV challenges (2015) (254)
HIV Vaccine Research: The Way Forward (2008) (250)
Sequential Immunization Elicits Broadly Neutralizing Anti-HIV-1 Antibodies in Ig Knockin Mice (2016) (249)
Rational antibody-based HIV-1 vaccine design: current approaches and future directions. (2010) (244)
Strain‐specified relative conformational stability of the scrapie prion protein (2001) (244)
Measuring prions causing bovine spongiform encephalopathy or chronic wasting disease by immunoassays and transgenic mice (2002) (244)
Accelerating Next-Generation Vaccine Development for Global Disease Prevention (2013) (243)
Mechanism of Neutralization by the Broadly Neutralizing HIV-1 Monoclonal Antibody VRC01 (2011) (240)
Human antibodies from combinatorial libraries. (1994) (237)
Elicitation of Robust Tier 2 Neutralizing Antibody Responses in Nonhuman Primates by HIV Envelope Trimer Immunization Using Optimized Approaches (2017) (236)
Variable Loop Glycan Dependency of the Broad and Potent HIV-1-Neutralizing Antibodies PG9 and PG16 (2010) (235)
A Native-Like SOSIP.664 Trimer Based on an HIV-1 Subtype B env Gene (2015) (234)
Neutralizing Antibody Fails to Impact the Course of Ebola Virus Infection in Monkeys (2007) (233)
Contrasting IgG structures reveal extreme asymmetry and flexibility. (2002) (233)
Generation of diverse high-affinity human monoclonal antibodies by repertoire cloning. (1991) (232)
Trafficking of prion proteins through a caveolae-mediated endosomal pathway (2003) (229)
Broadly cross-reactive HIV-1-neutralizing human monoclonal Fab selected for binding to gp120–CD4–CCR5 complexes (2002) (227)
A Change in the Conformation of Prions Accompanies the Emergence of a New Prion Strain (2002) (224)
A vaccine for HIV type 1: the antibody perspective. (1997) (221)
Autoantibodies to GPI in rheumatoid arthritis: linkage between an animal model and human disease (2001) (220)
Broad and potent activity against SARS-like viruses by an engineered human monoclonal antibody (2021) (219)
The Glycan Shield of HIV Is Predominantly Oligomannose Independently of Production System or Viral Clade (2011) (219)
Cytosolic Prion Protein in Neurons (2003) (217)
Composition and Antigenic Effects of Individual Glycan Sites of a Trimeric HIV-1 Envelope Glycoprotein (2016) (217)
Trispecific broadly neutralizing HIV antibodies mediate potent SHIV protection in macaques (2017) (216)
Tailored Immunogens Direct Affinity Maturation toward HIV Neutralizing Antibodies (2016) (213)
In vitro evolution of a neutralizing human antibody to human immunodeficiency virus type 1 to enhance affinity and broaden strain cross-reactivity. (1994) (213)
Heterogeneity of Envelope Molecules Expressed on Primary Human Immunodeficiency Virus Type 1 Particles as Probed by the Binding of Neutralizing and Nonneutralizing Antibodies (2003) (206)
Structure and function of broadly reactive antibody PG16 reveal an H3 subdomain that mediates potent neutralization of HIV-1 (2010) (206)
Mapping the Prion Protein Using Recombinant Antibodies (1998) (205)
Effector functions of a monoclonal aglycosylated mouse IgG2a: binding and activation of complement component C1 and interaction with human monocyte Fc receptor. (1985) (205)
Dissecting the Neutralizing Antibody Specificities of Broadly Neutralizing Sera from Human Immunodeficiency Virus Type 1-Infected Donors (2007) (204)
Passive immunotherapy of viral infections: 'super-antibodies' enter the fray (2018) (203)
Neutralization of Human Immunodeficiency Virus Type 1 by Antibody to gp120 Is Determined Primarily by Occupancy of Sites on the Virion Irrespective of Epitope Specificity (1998) (202)
Broadly neutralizing antibodies abrogate established hepatitis C virus infection (2014) (202)
Pre- and Postexposure Prophylaxis of Ebola Virus Infection in an Animal Model by Passive Transfer of a Neutralizing Human Antibody (2002) (200)
Holes in the Glycan Shield of the Native HIV Envelope Are a Target of Trimer-Elicited Neutralizing Antibodies. (2016) (196)
Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans. (2015) (194)
Tyrosine Sulfation of Human Antibodies Contributes to Recognition of the CCR5 Binding Region of HIV-1 gp120 (2003) (193)
Major Histocompatibility Complex Class I Alleles Associated with Slow Simian Immunodeficiency Virus Disease Progression Bind Epitopes Recognized by Dominant Acute-Phase Cytotoxic-T-Lymphocyte Responses (2003) (189)
Isolation of potent neutralizing antibodies from a survivor of the 2014 Ebola virus outbreak (2016) (186)
Identification and specificity of broadly neutralizing antibodies against HIV (2017) (186)
Promiscuous Glycan Site Recognition by Antibodies to the High-Mannose Patch of gp120 Broadens Neutralization of HIV (2014) (183)
An Affinity-Enhanced Neutralizing Antibody against the Membrane-Proximal External Region of Human Immunodeficiency Virus Type 1 gp41 Recognizes an Epitope between Those of 2F5 and 4E10 (2007) (183)
The Effects of Somatic Hypermutation on Neutralization and Binding in the PGT121 Family of Broadly Neutralizing HIV Antibodies (2013) (181)
Neutralization Synergy of Human Immunodeficiency Virus Type 1 Primary Isolates by Cocktails of Broadly Neutralizing Antibodies (2001) (180)
HIV-1 antibody — debris or virion? (1997) (179)
Human monoclonal Fab fragments derived from a combinatorial library bind to respiratory syncytial virus F glycoprotein and neutralize infectivity. (1992) (176)
A Broadly Neutralizing Antibody Targets the Dynamic HIV Envelope Trimer Apex via a Long, Rigidified, and Anionic β-Hairpin Structure (2017) (173)
Human combinatorial antibody libraries to hepatitis B surface antigen. (1992) (171)
Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies (2014) (164)
Identification of Common Features in Prototype Broadly Neutralizing Antibodies to HIV Envelope V2 Apex to Facilitate Vaccine Design. (2015) (163)
Human monoclonal antibodies against a plethora of viral pathogens from single combinatorial libraries. (1993) (162)
Immunization of hu-PBL–SCID mice and the rescue of human monoclonal Fab fragments through combinatorial libraries (1992) (160)
Macaques vaccinated with live-attenuated SIV control replication of heterologous virus (2008) (160)
Enhancing the Proteolytic Maturation of Human Immunodeficiency Virus Type 1 Envelope Glycoproteins (2002) (160)
Protection against HIV‐1 infection in hu‐PBL-SCID mice by passive immunization with a neutralizing human monoclonal antibody against the gp120 CD4‐binding site (1995) (159)
Slow Delivery Immunization Enhances HIV Neutralizing Antibody and Germinal Center Responses via Modulation of Immunodominance (2019) (159)
Global site-specific N-glycosylation analysis of HIV envelope glycoprotein (2017) (154)
Human Fc gamma RI and Fc gamma RII interact with distinct but overlapping sites on human IgG. (1991) (153)
Cross-reactive serum and memory B cell responses to spike protein in SARS-CoV-2 and endemic coronavirus infection (2020) (153)
Covalent display of oligosaccharide arrays in microtiter plates. (2004) (152)
Manipulating the selection forces during affinity maturation to generate cross-reactive HIV antibodies (2015) (151)
The C1q receptor site on immunoglobulin G (1980) (150)
Differential binding of neutralizing and non-neutralizing antibodies to native-like soluble HIV-1 Env trimers, uncleaved Env proteins, and monomeric subunits (2014) (149)
Systematic Analysis of Monoclonal Antibodies against Ebola Virus GP Defines Features that Contribute to Protection (2018) (148)
Redox-Triggered Infection by Disulfide-Shackled Human Immunodeficiency Virus Type 1 Pseudovirions (2003) (145)
Structural and functional ramifications of antigenic drift in recent SARS-CoV-2 variants (2021) (144)
Determinants of Human Immunodeficiency Virus Type 1 Envelope Glycoprotein Activation by Soluble CD4 and Monoclonal Antibodies (1998) (143)
Aspects of the molecular structure of IgG subclasses. (1986) (141)
Recombinant HIV Envelope Proteins Fail to Engage Germline Versions of Anti-CD4bs bNAbs (2013) (140)
Antigen selection from an HIV-1 immune antibody library displayed on yeast yields many novel antibodies compared to selection from the same library displayed on phage. (2007) (139)
Structure-Function Analysis of the Epitope for 4E10, a Broadly Neutralizing Human Immunodeficiency Virus Type 1 Antibody (2006) (139)
Passive neutralizing antibody controls SHIV viremia and enhances B cell responses in infant macaques (2010) (139)
Tetherin antagonism by Vpu protects HIV-infected cells from antibody-dependent cell-mediated cytotoxicity (2014) (139)
Mining the antibodyome for HIV-1–neutralizing antibodies with next-generation sequencing and phylogenetic pairing of heavy/light chains (2013) (139)
The antibody response in HIV-1 infection. (1997) (139)
Direct Probing of Germinal Center Responses Reveals Immunological Features and Bottlenecks for Neutralizing Antibody Responses to HIV Env Trimer. (2016) (138)
Structural basis of hepatitis C virus neutralization by broadly neutralizing antibody HCV1 (2012) (137)
Optimal Combinations of Broadly Neutralizing Antibodies for Prevention and Treatment of HIV-1 Clade C Infection (2016) (136)
Hyperglycosylated Mutants of Human Immunodeficiency Virus (HIV) Type 1 Monomeric gp120 as Novel Antigens for HIV Vaccine Design (2003) (136)
Human anti-nicotinic acetylcholine receptor recombinant Fab fragments isolated from thymus-derived phage display libraries from myasthenia gravis patients reflect predominant specificities in serum and block the action of pathogenic serum antibodies. (1997) (136)
A generalized HIV vaccine design strategy for priming of broadly neutralizing antibody responses (2019) (136)
Antibody redesign by chain shuffling from random combinatorial immunoglobulin libraries. (1991) (134)
A Sound Rationale Needed for Phase III HIV-1 Vaccine Trials (2004) (133)
Priming HIV-1 broadly neutralizing antibody precursors in human Ig loci transgenic mice (2016) (133)
Electron-Microscopy-Based Epitope Mapping Defines Specificities of Polyclonal Antibodies Elicited during HIV-1 BG505 Envelope Trimer Immunization (2018) (131)
A comparative immunogenicity study of HIV-1 virus-like particles bearing various forms of envelope proteins, particles bearing no envelope and soluble monomeric gp120. (2007) (131)
Structural basis of enhanced binding of extended and helically constrained peptide epitopes of the broadly neutralizing HIV-1 antibody 4E10. (2007) (131)
PGV04, an HIV-1 gp120 CD4 Binding Site Antibody, Is Broad and Potent in Neutralization but Does Not Induce Conformational Changes Characteristic of CD4 (2012) (130)
Structural and functional ramifications of antigenic drift in recent SARS-CoV-2 variants (2021) (130)
Inhibition of Virus Attachment to CD4+ Target Cells Is a Major Mechanism of T Cell Line–adapted HIV-1 Neutralization (1997) (130)
Structural Constraints Determine the Glycosylation of HIV-1 Envelope Trimers. (2015) (128)
Human autoantibody recognition of DNA. (1995) (128)
Presenting native-like trimeric HIV-1 antigens with self-assembling nanoparticles (2016) (128)
Genetic Subtypes, Humoral Immunity, and Human Immunodeficiency Virus Type 1 Vaccine Development (2001) (126)
Murine Antibody Responses to Cleaved Soluble HIV-1 Envelope Trimers Are Highly Restricted in Specificity (2015) (125)
Aromatic residues at the edge of the antibody combining site facilitate viral glycoprotein recognition through membrane interactions (2010) (125)
Coexistence of potent HIV-1 broadly neutralizing antibodies and antibody-sensitive viruses in a viremic controller (2017) (125)
The Long Third Complementarity-Determining Region of the Heavy Chain Is Important in the Activity of the Broadly Neutralizing Anti-Human Immunodeficiency Virus Type 1 Antibody 2F5 (2004) (124)
Motif-grafted antibodies containing the replicative interface of cellular PrP are specific for PrPSc. (2004) (123)
Recombinant human respiratory syncytial virus (RSV) monoclonal antibody Fab is effective therapeutically when introduced directly into the lungs of RSV-infected mice. (1994) (122)
Proton relaxation enhancement (PRE) in biochemistry: A critical survey (1979) (121)
Antibody-mediated protection against SHIV challenge includes systemic clearance of distal virus (2016) (121)
Rapid elicitation of broadly neutralizing antibodies to HIV by immunization in cows (2017) (120)
An HIV-1 antibody from an elite neutralizer implicates the fusion peptide as a site of vulnerability (2016) (119)
Early Antibody Lineage Diversification and Independent Limb Maturation Lead to Broad HIV-1 Neutralization Targeting the Env High-Mannose Patch. (2016) (118)
Why do we not have an HIV vaccine and how can we make one? (1998) (118)
Vaccine-Induced Protection from Homologous Tier 2 SHIV Challenge in Nonhuman Primates Depends on Serum-Neutralizing Antibody Titers (2019) (118)
A model for neutralization of viruses based on antibody coating of the virion surface. (2001) (117)
Circumventing tolerance to generate autologous monoclonal antibodies to the prion protein. (1996) (116)
Assorted Mutations in the Envelope Gene of Simian Immunodeficiency Virus Lead to Loss of Neutralization Resistance against Antibodies Representing a Broad Spectrum of Specificities (2003) (116)
A Prominent Site of Antibody Vulnerability on HIV Envelope Incorporates a Motif Associated with CCR5 Binding and Its Camouflaging Glycans. (2016) (115)
Role of Ebola Virus Secreted Glycoproteins and Virus-Like Particles in Activation of Human Macrophages (2005) (114)
Defining criteria for oligomannose immunogens for HIV using icosahedral virus capsid scaffolds. (2010) (113)
Comparing Antigenicity and Immunogenicity of Engineered gp120 (2005) (111)
A Nonfucosylated Variant of the anti-HIV-1 Monoclonal Antibody b12 Has Enhanced FcγRIIIa-Mediated Antiviral Activity In Vitro but Does Not Improve Protection against Mucosal SHIV Challenge in Macaques (2012) (111)
Quantitation of DNA and RNA. (2007) (110)
A Dominant Role for CD8+-T-Lymphocyte Selection in Simian Immunodeficiency Virus Sequence Variation (2004) (110)
Structure-based design of native-like HIV-1 envelope trimers to silence non-neutralizing epitopes and eliminate CD4 binding (2017) (109)
Multiple roles for HIV broadly neutralizing antibodies (2019) (108)
What Are the Most Powerful Immunogen Design Vaccine Strategies? Reverse Vaccinology 2.0 Shows Great Promise. (2017) (108)
Uncleaved prefusion-optimized gp140 trimers derived from analysis of HIV-1 envelope metastability (2016) (107)
Localisation of the monocyte-binding region on human immunoglobulin G. (1986) (107)
Antibody and virus: binding and neutralization. (2000) (107)
Neutralizing recombinant human antibodies to a conformational V2- and CD4-binding site-sensitive epitope of HIV-1 gp120 isolated by using an epitope-masking procedure. (1995) (106)
Antigenic and Immunogenic Study of Membrane-Proximal External Region-Grafted gp120 Antigens by a DNA Prime-Protein Boost Immunization Strategy (2007) (106)
Protection against a mixed SHIV challenge by a broadly neutralizing antibody cocktail (2017) (105)
Reactivity-based one-pot synthesis of oligomannoses: defining antigens recognized by 2G12, a broadly neutralizing anti-HIV-1 antibody. (2004) (105)
Synthetic glycopeptides reveal the glycan specificity of HIV-neutralizing antibodies (2013) (104)
Engineered immunogen binding to alum adjuvant enhances humoral immunity (2020) (104)
Absence of specific mucosal antibody responses in HIV-exposed uninfected sex workers from the Gambia (2000) (104)
Molecular Features of the Broadly Neutralizing Immunoglobulin G1 b12 Required for Recognition of Human Immunodeficiency Virus Type 1 gp120 (2003) (103)
Minimally Mutated HIV-1 Broadly Neutralizing Antibodies to Guide Reductionist Vaccine Design (2016) (103)
Comprehensive Antigenic Map of a Cleaved Soluble HIV-1 Envelope Trimer (2015) (102)
Rational Vaccine Design in the Time of COVID-19 (2020) (101)
Anti-DNA antibodies are a major component of the intrathecal B cell response in multiple sclerosis. (2001) (100)
A Glycoconjugate Antigen Based on the Recognition Motif of a Broadly Neutralizing Human Immunodeficiency Virus Antibody, 2G12, Is Immunogenic but Elicits Antibodies Unable To Bind to the Self Glycans of gp120 (2008) (100)
Slow Delivery Immunization Enhances HIV Neutralizing Antibody and Germinal Center Responses via Modulation of Immunodominance (2018) (99)
Cross-reactive serum and memory B-cell responses to spike protein in SARS-CoV-2 and endemic coronavirus infection (2021) (99)
A Conformational Switch in Human Immunodeficiency Virus gp41 Revealed by the Structures of Overlapping Epitopes Recognized by Neutralizing Antibodies (2009) (99)
Recombinant human Fab to glycoprotein D neutralizes infectivity and prevents cell-to-cell transmission of herpes simplex viruses 1 and 2 in vitro. (1994) (99)
Directed evolution of an anti-prion protein scFv fragment to an affinity of 1 pM and its structural interpretation. (2006) (99)
Comparison of Antibody-Dependent Cell-Mediated Cytotoxicity and Virus Neutralization by HIV-1 Env-Specific Monoclonal Antibodies (2016) (98)
Differential processing of HIV envelope glycans on the virus and soluble recombinant trimer (2018) (98)
Recombinant human monoclonal antibodies to Ebola virus. (1999) (96)
The interaction of core histones with DNA: equilibrium binding studies. (1978) (96)
Variation in HIV-1 R5 macrophage-tropism correlates with sensitivity to reagents that block envelope: CD4 interactions but not with sensitivity to other entry inhibitors (2008) (95)
Rapid antibody responses by low-dose, single-step, dendritic cell-targeted immunization. (2000) (95)
Immune Tolerance Negatively Regulates B Cells in Knock-In Mice Expressing Broadly Neutralizing HIV Antibody 4E10 (2013) (95)
The solution conformations of the subclasses of human IgG deduced from sedimentation and small angle X-ray scattering studies. (1987) (95)
Human antibody responses to HIV type 1 glycoprotein 41 cloned in phage display libraries suggest three major epitopes are recognized and give evidence for conserved antibody motifs in antigen binding. (1996) (94)
Identification and Characterization of a Peptide That Specifically Binds the Human, Broadly Neutralizing Anti-Human Immunodeficiency Virus Type 1 Antibody b12 (2001) (94)
Neutralizing Monoclonal Antibodies Block Human Immunodeficiency Virus Type 1 Infection of Dendritic Cells and Transmission to T Cells (1998) (93)
Direct Antibody Access to the HIV-1 Membrane-Proximal External Region Positively Correlates with Neutralization Sensitivity (2011) (92)
Recombinant human monoclonal antibody IgG1b12 neutralizes diverse human immunodeficiency virus type 1 primary isolates. (1997) (91)
A nonself sugar mimic of the HIV glycan shield shows enhanced antigenicity (2010) (90)
Broadly neutralizing antibodies targeting the HIV-1 envelope V2 apex confer protection against a clade C SHIV challenge (2017) (90)
Molecular selection of human antibodies with an unconventional bacterial B cell antigen. (1993) (89)
Characterization of Primary Isolate-Like Variants of Simian-Human Immunodeficiency Virus (1999) (89)
Antibodies without immunization. (1992) (88)
Rapid development of glycan-specific, broad, and potent anti–HIV-1 gp120 neutralizing antibodies in an R5 SIV/HIV chimeric virus infected macaque (2011) (88)
Advancing an HIV vaccine; advancing vaccinology (2018) (87)
Determinants Flanking the CD4 Binding Loop Modulate Macrophage Tropism of Human Immunodeficiency Virus Type 1 R5 Envelopes (2009) (87)
Antibody Neutralization-Resistant Primary Isolates of Human Immunodeficiency Virus Type 1 (1998) (86)
Human immunodeficiency virus type 1 mutants that escape neutralization by human monoclonal antibody IgG1b12. off (1997) (85)
Antibody-mediated neutralization of Ebola virus can occur by two distinct mechanisms (2010) (85)
Toward a more accurate view of human B-cell repertoire by next-generation sequencing, unbiased repertoire capture and single-molecule barcoding (2014) (85)
Identification and Characterization of a New Cross-Reactive Human Immunodeficiency Virus Type 1-Neutralizing Human Monoclonal Antibody (2004) (84)
Antibodies to a conformational epitope on gp41 neutralize HIV-1 by destabilizing the Env spike (2015) (84)
The Neonatal Fc Receptor (FcRn) Enhances Human Immunodeficiency Virus Type 1 (HIV-1) Transcytosis across Epithelial Cells (2013) (84)
HIV Envelope Glycoform Heterogeneity and Localized Diversity Govern the Initiation and Maturation of a V2 Apex Broadly Neutralizing Antibody Lineage (2017) (82)
A Short Segment of the HIV-1 gp120 V1/V2 Region Is a Major Determinant of Resistance to V1/V2 Neutralizing Antibodies (2012) (82)
Neutralizing human monoclonal antibodies prevent Zika virus infection in macaques (2017) (82)
Directed selection of recombinant human monoclonal antibodies to herpes simplex virus glycoproteins from phage display libraries. (1995) (82)
Zika virus activates de novo and cross-reactive memory B cell responses in dengue-experienced donors (2017) (82)
Selection and evolution of high-affinity human anti-viral antibodies. (1996) (81)
Relevance of the antibody response against human immunodeficiency virus type 1 envelope to vaccine design. (1997) (81)
Two Classes of Broadly Neutralizing Antibodies within a Single Lineage Directed to the High-Mannose Patch of HIV Envelope (2014) (81)
Difficulties in eliciting broadly neutralizing anti-HIV antibodies are not explained by cardiolipin autoreactivity (2007) (79)
Structure of antibody F425-B4e8 in complex with a V3 peptide reveals a new binding mode for HIV-1 neutralization. (2008) (79)
Modular synthesis of N-glycans and arrays for the hetero-ligand binding analysis of HIV antibodies. (2016) (78)
A binary plasmid system for shuffling combinatorial antibody libraries. (1992) (78)
Antibody: the flexible adaptor molecule. (1990) (78)
Developing an HIV vaccine (2017) (78)
HIV–1 neutralizing antibodies: How full is the bottle? (1999) (78)
Correction: Recombinant HIV Envelope Proteins Fail to Engage Germline Versions of Anti-CD4bs bNAbs (2013) (78)
Nonneutralizing Antibodies to the CD4-Binding Site on the gp120 Subunit of Human Immunodeficiency Virus Type 1 Do Not Interfere with the Activity of a Neutralizing Antibody against the Same Site (2003) (78)
Sugar Determines Antibody Activity (2006) (77)
Simian Immunodeficiency Virus Engrafted with Human Immunodeficiency Virus Type 1 (HIV-1)-Specific Epitopes: Replication, Neutralization, and Survey of HIV-1-Positive Plasma (2006) (77)
Scaffolding to build a rational vaccine design strategy (2010) (77)
Ebola Virion Attachment and Entry into Human Macrophages Profoundly Effects Early Cellular Gene Expression (2011) (77)
A Boost for HIV Vaccine Design (2010) (77)
bNAber: database of broadly neutralizing HIV antibodies (2013) (76)
Antibody 2G12 Recognizes Di-Mannose Equivalently in Domain- and Nondomain-Exchanged Forms but Only Binds the HIV-1 Glycan Shield if Domain Exchanged (2010) (76)
Strategies for a multi-stage neutralizing antibody-based HIV vaccine. (2018) (74)
Natural Resistance of Human Immunodeficiency Virus Type 1 to the CD4bs Antibody b12 Conferred by a Glycan and an Arginine Residue Close to the CD4 Binding Loop (2008) (74)
Incomplete Neutralization and Deviation from Sigmoidal Neutralization Curves for HIV Broadly Neutralizing Monoclonal Antibodies (2015) (74)
Total synthesis, revised structure, and biological evaluation of biyouyanagin A and analogues thereof. (2008) (73)
Analysis of the neutralization breadth of the anti-V3 antibody F425-B4e8 and re-assessment of its epitope fine specificity by scanning mutagenesis. (2007) (71)
A Novel Human Antibody against Human Immunodeficiency Virus Type 1 gp120 Is V1, V2, and V3 Loop Dependent and Helps Delimit the Epitope of the Broadly Neutralizing Antibody Immunoglobulin G1 b12 (2003) (69)
A Recombinant Human Monoclonal Antibody to Human Metapneumovirus Fusion Protein That Neutralizes Virus In Vitro and Is Effective Therapeutically In Vivo (2007) (68)
Inhibition of mammalian glycan biosynthesis produces non-self antigens for a broadly neutralising, HIV-1 specific antibody. (2007) (68)
Identification of an HIV-1 Clade A Envelope That Exhibits Broad Antigenicity and Neutralization Sensitivity and Elicits Antibodies Targeting Three Distinct Epitopes (2013) (68)
Protein and Glycan Mimicry in HIV Vaccine Design (2019) (68)
Determinants of polyreactivity in a large panel of recombinant human antibodies from HIV-1 infection. (1996) (68)
The carbohydrate epitope of the neutralizing anti-HIV-1 antibody 2G12. (2003) (67)
Structure of a high-affinity "mimotope" peptide bound to HIV-1-neutralizing antibody b12 explains its inability to elicit gp120 cross-reactive antibodies. (2007) (67)
Neutralizing Epitopes in the Membrane-Proximal External Region of HIV-1 gp41 Are Influenced by the Transmembrane Domain and the Plasma Membrane (2012) (66)
Somatic Populations of PGT135–137 HIV-1-Neutralizing Antibodies Identified by 454 Pyrosequencing and Bioinformatics (2012) (66)
A broadly neutralizing human monoclonal antibody exhibits in vivo efficacy against both human metapneumovirus and respiratory syncytial virus. (2015) (66)
Potential of conventional & bispecific broadly neutralizing antibodies for prevention of HIV-1 subtype A, C & D infections (2018) (65)
Copper refolding of prion protein. (2000) (65)
HIV-1 neutralization: mechanisms and relevance to vaccine design. (2007) (65)
Cloning and expression of a novel human antibody-antigen pair associated with Felty's syndrome. (2000) (64)
Macaques Vaccinated with Simian Immunodeficiency Virus SIVmac239Δnef Delay Acquisition and Control Replication after Repeated Low-Dose Heterologous SIV Challenge (2010) (64)
Mapping polyclonal antibody responses in non-human primates vaccinated with HIV Env trimer subunit vaccines (2019) (63)
Vaccines and the induction of functional antibodies: Time to look beyond the molecules of natural infection? (2000) (63)
A Panel of IgG1 b12 Variants with Selectively Diminished or Enhanced Affinity for Fcγ Receptors To Define the Role of Effector Functions in Protection against HIV (2011) (63)
Improved design of an antigen with enhanced specificity for the broadly HIV-neutralizing antibody b12. (2004) (63)
Synergistic neutralization of a chimeric SIV/HIV type 1 virus with combinations of human anti-HIV type 1 envelope monoclonal antibodies or hyperimmune globulins. (1997) (63)
Live Simian Immunodeficiency Virus Vaccine Correlate of Protection: Local Antibody Production and Concentration on the Path of Virus Entry (2014) (61)
Mapping the protein surface of human immunodeficiency virus type 1 gp120 using human monoclonal antibodies from phage display libraries. (1997) (60)
Structure of 2G12 Fab2 in Complex with Soluble and Fully Glycosylated HIV-1 Env by Negative-Stain Single-Particle Electron Microscopy (2014) (60)
Immobilized prion protein undergoes spontaneous rearrangement to a conformation having features in common with the infectious form (2001) (60)
Rapid isolation of potent SARS-CoV-2 neutralizing antibodies and protection in a small animal model (2020) (60)
Cellular Immunity Elicited by Human Immunodeficiency Virus Type 1/ Simian Immunodeficiency Virus DNA Vaccination Does Not Augment the Sterile Protection Afforded by Passive Infusion of Neutralizing Antibodies (2003) (60)
Fetal demise and failed antibody therapy during Zika virus infection of pregnant macaques (2018) (60)
HIV-1 vaccine design through minimizing envelope metastability (2018) (58)
Anti-HIV B Cell Lines as Candidate Vaccine Biosensors (2012) (58)
The CCR5 receptor acts as an alloantigen in CCR5Delta32 homozygous individuals: identification of chemokineand HIV-1-blocking human antibodies. (1998) (58)
An aptamer that neutralizes R5 strains of HIV-1 binds to core residues of gp120 in the CCR5 binding site. (2008) (57)
Neutralizing activity of antibodies to the V3 loop region of HIV-1 gp120 relative to their epitope fine specificity. (2008) (57)
A Neutralizing Antibody Recognizing Primarily N‐Linked Glycan Targets the Silent Face of the HIV Envelope (2018) (57)
Human Antibody Responses to Mature and Immature Forms of Viral Envelope in Respiratory Syncytial Virus Infection: Significance for Subunit Vaccines (1999) (56)
Mode of action for linear peptide inhibitors of HIV-1 gp120 interactions. (2004) (56)
Global site-specific analysis of glycoprotein N-glycan processing (2018) (56)
Potent neutralization of primary human immunodeficiency virus clade C isolates with a synergistic combination of human monoclonal antibodies raised against clade B. (2001) (56)
Efficient recovery of high-affinity antibodies from a single-chain Fab yeast display library. (2009) (55)
N-Butyldeoxynojirimycin is a broadly effective anti-HIV therapy significantly enhanced by targeted liposome delivery (2008) (55)
Crystallohydrodynamics for solving the hydration problem for multi-domain proteins: open physiological conformations for human IgG. (2001) (55)
A Meta-analysis of Passive Immunization Studies Shows that Serum-Neutralizing Antibody Titer Associates with Protection against SHIV Challenge. (2019) (55)
Structure and Recognition of a Novel HIV-1 gp120-gp41 Interface Antibody that Caused MPER Exposure through Viral Escape (2017) (54)
Lipid interactions and angle of approach to the HIV-1 viral membrane of broadly neutralizing antibody 10E8: Insights for vaccine and therapeutic design (2017) (54)
Antibody binding defines a structure for an epitope that participates in the PrPC-->PrPSc conformational change. (1999) (53)
Rapid and Focused Maturation of a VRC01-Class HIV Broadly Neutralizing Antibody Lineage Involves Both Binding and Accommodation of the N276-Glycan (2019) (53)
The nature of the autoimmune antibody repertoire in human immunodeficiency virus type 1 infection. (1994) (52)
Crystallization and preliminary structure determination of an intact human immunoglobulin, b12: an antibody that broadly neutralizes primary isolates of HIV-1. (2001) (52)
Cryptic epitopes in N‐terminally truncated prion protein are exposed in the full‐length molecule: Dependence of conformation on pH (2001) (52)
Antibody elicited against the gp41 N-heptad repeat (NHR) coiled-coil can neutralize HIV-1 with modest potency but non-neutralizing antibodies also bind to NHR mimetics. (2008) (51)
Transplanting Supersites of HIV-1 Vulnerability (2014) (51)
In vitro antigen challenge of human antibody libraries for vaccine evaluation: the human immunodeficiency virus type 1 envelope (1996) (51)
Crystal structure of the broadly cross-reactive HIV-1-neutralizing Fab X5 and fine mapping of its epitope. (2004) (51)
Reprogramming the antigen specificity of B cells using genome-editing technologies (2018) (50)
The brain ’ s functional network architecture reveals human motives (49)
Glycans Function as Anchors for Antibodies and Help Drive HIV Broadly Neutralizing Antibody Development. (2017) (49)
Monoclonal antibody-resistant mutants selected with a respiratory syncytial virus-neutralizing human antibody fab fragment (Fab 19) define a unique epitope on the fusion (F) glycoprotein. (1998) (49)
gp41: HIV's shy protein (2004) (49)
Recombinant human antibodies: linkage of an Fab fragment from a combinatorial library to an Fc fragment for expression in mammalian cell culture. (1993) (49)
Enhanced Exposure of the CD4-Binding Site to Neutralizing Antibodies by Structural Design of a Membrane-Anchored Human Immunodeficiency Virus Type 1 gp120 Domain (2009) (48)
Drug repurposing screens identify chemical entities for the development of COVID-19 interventions (2021) (48)
Immunofocusing: antigen engineering to promote the induction of HIV-neutralizing antibodies. (2003) (48)
A human antibody reveals a conserved site on beta-coronavirus spike proteins and confers protection against SARS-CoV-2 infection (2022) (48)
Focused dampening of antibody response to the immunodominant variable loops by engineered soluble gp140. (2008) (47)
Dibutyryl cyclic AMP stimulation of a monocyte-like cell line, U937: a model for monocyte chemotaxis and Fc receptor-related functions. (1988) (47)
Selection of unadapted, pathogenic SHIVs encoding newly transmitted HIV-1 envelope proteins. (2014) (47)
Role of Antibodies in Controlling Viral Disease: Lessons from Experiments of Nature and Gene Knockouts (2000) (47)
The INNs and outs of antibody nonproprietary names (2015) (46)
A human antibody reveals a conserved site on beta-coronavirus spike proteins and confers protection against SARS-CoV-2 infection (2022) (46)
Mapping the immunogenic landscape of near-native HIV-1 envelope trimers in non-human primates (2020) (46)
Human and mouse monoclonal antibodies by repertoire cloning. (1991) (46)
Very Few Substitutions in a Germ Line Antibody Are Required To Initiate Significant Domain Exchange (2010) (46)
Effective ex vivo neutralization of human immunodeficiency virus type 1 in plasma by recombinant immunoglobulin molecules (1996) (45)
Functional Stability of Unliganded Envelope Glycoprotein Spikes among Isolates of Human Immunodeficiency Virus Type 1 (HIV-1) (2011) (45)
Simian Immunodeficiency Virus (SIV) Envelope-Specific Fabs with High-Level Homologous Neutralizing Activity: Recovery from a Long-Term-Nonprogressor SIV-Infected Macaque (1998) (45)
Clonify: unseeded antibody lineage assignment from next-generation sequencing data (2016) (44)
Neutralizing antibody affords comparable protection against vaginal and rectal simian/human immunodeficiency virus challenge in macaques (2016) (44)
Elicitation of Neutralizing Antibodies Targeting the V2 Apex of the HIV Envelope Trimer in a Wild-Type Animal Model (2017) (44)
Combinatorial immunoglobulin libraries in phage λ (1991) (44)
Making autoantibodies safe (2008) (44)
Protection of nude mice by passive immunization with a type-common human recombinant monoclonal antibody against HSV. (1996) (44)
Urgently needed: a filter for the HIV-1 vaccine pipeline (2004) (43)
Neutralizing Polyclonal IgG Present during Acute Infection Prevents Rapid Disease Onset in Simian-Human Immunodeficiency Virus SHIVSF162P3-Infected Infant Rhesus Macaques (2013) (42)
Neutralizing Human Fab Fragments against Measles Virus Recovered by Phage Display (2002) (42)
Inhibition of HIV-1 Infectivity and Epithelial Cell Transfer by Human Monoclonal IgG and IgA Antibodies Carrying the b12 V Region1 (2007) (41)
B Cells from Knock-in Mice Expressing Broadly Neutralizing HIV Antibody b12 Carry an Innocuous B Cell Receptor Responsive to HIV Vaccine Candidates (2013) (41)
N332-Directed Broadly Neutralizing Antibodies Use Diverse Modes of HIV-1 Recognition: Inferences from Heavy-Light Chain Complementation of Function (2013) (41)
Libraries against libraries for combinatorial selection of replicating antigen–antibody pairs (2009) (40)
MONOCLONAL ANTIBODIES FROM COMBINATORIAL LIBRARIES (1993) (40)
Topically applied human recombinant monoclonal IgG1 antibody and its Fab and F(ab')2 fragments protect mice from vaginal transmission of HSV-2. (1996) (39)
The monocyte binding domain(s) on human immunoglobulin G. (1984) (39)
The interaction of protein A and Fc fragment of rabbit immunoglobulin G as probed by complement-fixation and nuclear-magnetic-resonance studies. (1977) (39)
Human Recombinant Antimannan Immunoglobulin G1 Antibody Confers Resistance to Hematogenously Disseminated Candidiasis in Mice (2006) (39)
Conformation of PrP(C) on the cell surface as probed by antibodies. (2003) (39)
Molecular recognition of antibody (IgG) by cellular Fc receptor (FcRI). (1988) (38)
Polymorphisms and Interspecies Differences of the Activating and Inhibitory FcγRII of Macaca nemestrina Influence the Binding of Human IgG Subclasses (2014) (38)
Immunology. Sugar determines antibody activity. (2006) (38)
Crystal structure of an intact human IgG: antibody asymmetry, flexibility, and a guide for HIV-1 vaccine design. (2003) (38)
Cloning and characterisation of TPO autoantibodies using combinatorial phage display libraries. (1994) (37)
Inhibition of HIV Env binding to cellular receptors by monoclonal antibody 2G12 as probed by Fc-tagged gp120 (2006) (36)
Is IgM-like dislocation a common feature of antibody function? (1986) (36)
Comparison of human monocytes isolated by elutriation and adherence suggests that heterogeneity may reflect a continuum of maturation/activation states. (1988) (36)
A peptide inhibitor of HIV‐1 neutralizing antibody 2G12 is not a structural mimic of the natural carbohydrate epitope on gp120 (2008) (35)
Mechanisms of escape from the PGT128 family of anti-HIV broadly neutralizing antibodies (2016) (35)
Molecular analysis of the human autoantibody response to alpha-fodrin in Sjögren's syndrome reveals novel apoptosis-induced specificity. (2004) (35)
Protective Efficacy of Broadly Neutralizing Antibodies with Incomplete Neutralization Activity against Simian-Human Immunodeficiency Virus in Rhesus Monkeys (2017) (34)
The interaction of polyamines with DNA: a 23Na NMR study. (1981) (34)
An MPER antibody neutralizes HIV-1 using germline features shared among donors (2019) (33)
A Protective Monoclonal Antibody Targets a Site of Vulnerability on the Surface of Rift Valley Fever Virus (2018) (33)
Protection of Humanized Mice From Repeated Intravaginal HIV Challenge by Passive Immunization: A Model for Studying the Efficacy of Neutralizing Antibodies In Vivo. (2016) (33)
Cloning the antibody response in humans with inflammatory CNS disease: isolation of measles virus-specific antibodies from phage display libraries of a subacute sclerosing panencephalitis brain (1999) (33)
Variant-proof vaccines — invest now for the next pandemic (2021) (33)
The use of anti-IgG monoclonal antibodies in mapping the monocyte receptor site on IgG. (1986) (33)
Rapid Germinal Center and Antibody Responses in Non-human Primates after a Single Nanoparticle Vaccine Immunization (2019) (33)
Design, synthesis, and biological evaluation of a biyouyanagin compound library (2011) (33)
Selection of recombinant anti-HuD Fab fragments from a phage display antibody library of a lung cancer patient with paraneoplastic encephalomyelitis (1998) (33)
Search for supersymmetry in the all-hadronic final state using top quark tagging in pp collisions at s=13 TeV (2017) (32)
Antigenic mimicry of the HIV envelope by AIDS-associated pathogens (2008) (32)
On the use of combinatorial antibody libraries to clone the "fossil record" of an individual's immune response. (1991) (32)
Characterization of a Type-Common Human Recombinant Monoclonal Antibody to Herpes Simplex Virus with High Therapeutic Potential (1998) (32)
Human monoclonal antibody Fab fragments cloned from combinatorial libraries: potential usefulness in prevention and/or treatment of major human viral diseases. (1993) (32)
Vaccine elicitation of HIV broadly neutralizing antibodies from engineered B cells (2020) (31)
Structural definition of a pan-sarbecovirus neutralizing epitope on the spike S2 subunit (2021) (31)
Unprecedented Role of Hybrid N-Glycans as Ligands for HIV-1 Broadly Neutralizing Antibodies. (2018) (31)
An engineered mutant of HIV-1 gp120 formulated with adjuvant Quil A promotes elicitation of antibody responses overlapping the CD4-binding site. (2012) (31)
Interaction of human IgG chimeric antibodies with the human FcRI and FcRII receptors: requirements for antibody-mediated host cell-target cell interaction. (1989) (30)
A protective broadly cross-reactive human antibody defines a conserved site of vulnerability on beta-coronavirus spikes. (2021) (30)
Haplotype-Phased Synthetic Long Reads from Short-Read Sequencing (2015) (30)
Ebola Virus, Neutrophils, and Antibody Specificity (1998) (30)
The regulation of actin polymerization in differentiating U937 cells correlates with increased membrane levels of the pertussis-toxin-sensitive G-protein Gi2. (1991) (30)
Differential Antibody Responses to Conserved HIV-1 Neutralizing Epitopes in the Context of Multivalent Scaffolds and Native-Like gp140 Trimers (2017) (29)
Antibodies against HIV-1 from phage display libraries: mapping of an immune response and progress towards antiviral immunotherapy. (1997) (29)
Autologous Antibody Responses to an HIV Envelope Glycan Hole Are Not Easily Broadened in Rabbits (2020) (29)
Cloning of a human autoimmune response: preparation and sequencing of a human anti-thyroglobulin autoantibody using a combinatorial approach. (1992) (28)
Erratum to "Relevance of the antibody response against human immunodeficiency virus type 1 envelope to vaccine design". (1997) (28)
Unusual Features of Vaccinia Virus Extracellular Virion Form Neutralization Resistance Revealed in Human Antibody Responses to the Smallpox Vaccine (2012) (27)
A natural mutation between SARS-CoV-2 and SARS-CoV determines neutralization by a cross-reactive antibody (2020) (27)
Targeting the HIV-1 Spike and Coreceptor with Bi- and Trispecific Antibodies for Single-Component Broad Inhibition of Entry (2018) (27)
Enhanced Exposure of the CD 4-Binding Site to Neutralizing Antibodies by Structural Design of a Membrane-Anchored Human Immunodeficiency Virus Type 1 gp 120 Domain (2009) (26)
Expression of a human monoclonal anti-(rhesus D) Fab fragment in Escherichia coli with the use of bacteriophage lambda vectors. (1991) (26)
A combination of cross-neutralizing antibodies synergizes to prevent SARS-CoV-2 and SARS-CoV pseudovirus infection (2021) (26)
HIV-1 escapes from N332-directed antibody neutralization in an elite neutralizer by envelope glycoprotein elongation and introduction of unusual disulfide bonds (2016) (26)
Techniques and tactics used in determining the structure of the trimeric ebolavirus glycoprotein. (2009) (26)
The Chimpanzee SIV Envelope Trimer: Structure and Deployment as an HIV Vaccine Template (2019) (25)
Broad sarbecovirus neutralizing antibodies define a key site of vulnerability on the SARS-CoV-2 spike protein (2020) (25)
Formation of complement subcomponent C1q-immunoglobulin G complex. Thermodynamic and chemical-modification studies. (1982) (25)
Tumor-infiltrating immune repertoires captured by single-cell barcoding in emulsion (2017) (25)
A novel approach to water proton relaxation in paramagnetic ion-macromolecule complexes. (1977) (25)
AI-guided discovery of the invariant host response to viral pandemics (2020) (24)
Infection of monkeys by simian-human immunodeficiency viruses with transmitted/founder clade C HIV-1 envelopes. (2015) (24)
The Human Immunodeficiency Virus Type 1 Envelope Spike of Primary Viruses Can Suppress Antibody Access to Variable Regions (2008) (24)
Human recombinant Puumala virus antibodies: cross-reaction with other hantaviruses and use in diagnostics. (1998) (24)
A particulate saponin/TLR agonist vaccine adjuvant alters lymph flow and modulates adaptive immunity (2021) (24)
IDEPI: Rapid Prediction of HIV-1 Antibody Epitopes and Other Phenotypic Features from Sequence Data Using a Flexible Machine Learning Platform (2014) (23)
Copper has differential effect on prion protein with polymorphism of position 129. (2000) (23)
Neutron scattering studies of subcomponent C1q of first component C1 of human complement and its association with subunit C1r2C1s2 within C1. (1984) (23)
Molecular immunologic strategies to identify antigens and b-cell responses unique to multiple sclerosis. (2001) (23)
Antibodies from libraries (1992) (23)
Structural basis of a public antibody response to SARS-CoV-2 (2020) (23)
Targeted isolation of diverse human protective broadly neutralizing antibodies against SARS-like viruses (2022) (23)
Site-specific steric control of SARS-CoV-2 spike glycosylation (2021) (23)
Detection of antibodies against the four subtypes of ebola virus in sera from any species using a novel antibody-phage indicator assay. (2002) (22)
Immunogenic and Antigenic Epitopes of Immunoglobulins Binding of Human Monoclonal Anti‐D Antibodies to FcRI on the Monocyte‐Like U937 Cell Line (1988) (22)
Neutralization Properties of Simian Immunodeficiency Viruses Infecting Chimpanzees and Gorillas (2015) (22)
A model for the solution conformation of rat IgE. (1990) (22)
Simplifying the synthesis of SIgA: combination of dIgA and rhSC using affinity chromatography. (2014) (21)
Generation of chimeric C5a/formyl peptide receptors: towards the identification of the human C5a receptor binding site (1994) (21)
Fighting the Ebola virus (2000) (21)
Square-Dancing Antibodies (2007) (21)
Computational Prediction of Broadly Neutralizing HIV-1 Antibody Epitopes from Neutralization Activity Data (2013) (21)
Human antibodies to HIV-1 by recombinant DNA methods. (1993) (21)
Antibodies to West Nile virus: a double-edged sword. (2007) (20)
Site-Specific Steric Control of SARS-CoV-2 Spike Glycosylation (2021) (20)
Generation of a large combinatorial library of the immunoglobulin repertoire in phage lambda. 1989. (1992) (20)
2G12-Expressing B Cell Lines May Aid in HIV Carbohydrate Vaccine Design Strategies (2012) (19)
Human monoclonal Fab fragments from a combinatorial library prepared from an individual with a low serum titer to a virus. (1994) (19)
Synthesis and biological evaluation of 2',4'- and 3',4'-bridged nucleoside analogues. (2011) (19)
Copper induces conformational changes in the N-terminal part of cell-surface PrPC (2006) (19)
Recognition of DNA by Synthetic Antibodies (1994) (19)
A human inferred germline antibody binds to an immunodominant epitope and neutralizes Zika virus (2017) (19)
Fine epitope signature of antibody neutralization breadth at the HIV-1 envelope CD4-binding site (2018) (19)
Potent Inhibition of HIV‐1 Entry with a Chemically Programmed Antibody Aided by an Efficient Organocatalytic Synthesis (2010) (18)
Mapping Neutralizing Antibody Epitope Specificities to an HIV Env Trimer in Immunized and in Infected Rhesus Macaques (2020) (18)
Anti-acetylcholine receptor Fab fragments isolated from thymus-derived phage display libraries from myasthenia gravis patients reflect predominant specificities in serum and block the action of pathogenic serum antibodies. (1997) (18)
Diverse immunoglobulin gene usage and convergent epitope targeting in neutralizing antibody responses to SARS-CoV-2 (2021) (18)
Antibodies against HIV-1 from Phage Display Libraries: Mapping of an Immune Response and Progress towards Antiviral Immunotherapy (1996) (18)
Antibodies from primary humoral responses modulate the recruitment of naive B cells during secondary responses (2022) (18)
Oral drug repositioning candidates and synergistic remdesivir combinations for the prophylaxis and treatment of COVID-19 (2020) (18)
Characterization by serial deletion competition ELISAs of HIV-1 V3 loop epitopes recognized by monoclonal antibodies. (1996) (18)
Characteristics of immunity induced by viral antigen or conferred by antibody via different administration routes (2002) (18)
Difficulties in determining accurate molecular motion parameters from proton relaxation enhancement measurements as illustrated by the immunoglobulin G-Gd(III) system. (1976) (18)
Antibody Conjugation Approach Enhances Breadth and Potency of Neutralization of Anti-HIV-1 Antibodies and CD4-IgG (2013) (18)
Vaccine-induced immune responses against both Gag and Env improve control of simian immunodeficiency virus replication in rectally challenged rhesus macaques (2017) (18)
Structure of a High-Affinity (2007) (17)
Another HIV vaccine failure: where to next? (2013) (17)
A Directed Molecular Evolution Approach to Improved Immunogenicity of the HIV-1 Envelope Glycoprotein (2011) (17)
Antibodies in viral infection (2001) (17)
Dhanier Ft Broadly neutralizing antibodies targeted to the membrane-proximal external region of human immunodeficiency virus type 1 glycoprotein gp 41 (2009) (17)
Protection against High-Dose Highly Pathogenic Mucosal SIV Challenge at Very Low Serum Neutralizing Titers of the Antibody-Like Molecule CD4-IgG2 (2012) (17)
Characterization of Human Immunodeficiency Virus Type 1 (HIV-1) Gag- and Gag Peptide-Specific CD4+ T-Cell Clones from an HIV-1-Seronegative Donor following In Vitro Immunization (2002) (17)
Broadly neutralizing anti-S2 antibodies protect against all three human betacoronaviruses that cause severe disease (2022) (16)
Disassembly of HIV envelope glycoprotein trimer immunogens is driven by antibodies elicited via immunization (2021) (16)
Disassembly of HIV envelope glycoprotein trimer immunogens is driven by antibodies elicited via immunization (2021) (16)
HIV envelope trimer-elicited autologous neutralizing antibodies bind a region overlapping the N332 glycan supersite (2019) (16)
A broad and potent neutralization epitope in SARS-related coronaviruses (2022) (16)
Macaque Long-Term Nonprogressors Resist Superinfection with Multiple CD8+ T Cell Escape Variants of Simian Immunodeficiency Virus (2010) (16)
AI-guided discovery of the invariant host response to viral pandemics (2021) (16)
Structural biology: Images from the surface of HIV (2006) (15)
pFab-CMV, a single vector system for the rapid conversion of recombinant Fabs into whole IgG1 antibodies. (1999) (15)
Neutron scattering studies of the isolated C1r2C1s2 subunit of first component of human complement in solution. (1983) (15)
An Engineered Antibody with Broad Protective Efficacy in Murine Models of SARS and COVID-19 (2020) (15)
Recognition properties of a sequence-specific DNA binding antibody. (1998) (15)
Cloning the Antibody Response in Humans with Chronic Inflammatory Disease: Immunopanning of Subacute Sclerosing Panencephalitis (SSPE) Brain Sections with Antibody Phage Libraries Prepared from SSPE Brain Enriches for Antibody Recognizing Measles Virus Antigens In Situ (2000) (14)
Molecular characterization of the circulating anti-HIV-1 gp120-specific B cell repertoire using antibody phage display libraries generated from pre-selected HIV-1 gp120 binding PBLs. (2005) (14)
Potent Plasmablast-Derived Antibodies Elicited by the National Institutes of Health Dengue Vaccine (2017) (14)
Hidden Lineage Complexity of Glycan-Dependent HIV-1 Broadly Neutralizing Antibodies Uncovered by Digital Panning and Native-Like gp140 Trimer (2017) (14)
Chapter 1 Structure and function of antibodies (1987) (14)
Chemically Programmed Antibodies AS HIV-1 Attachment Inhibitors. (2013) (14)
Polyclonal antibody responses to HIV Env immunogens resolved using cryoEM (2021) (14)
Human monoclonal Fab fragments specific for viral antigens from combinatorial IgA libraries. (1995) (14)
Effector function does not contribute to protection from virus challenge by a highly potent HIV broadly neutralizing antibody in nonhuman primates (2021) (14)
Structural basis of broad HIV neutralization by a vaccine-induced cow antibody (2020) (14)
Preparation and activities of macromolecule conjugates of the CCR5 antagonist Maraviroc. (2014) (13)
Long-primed germinal centres with enduring affinity maturation and clonal migration (2022) (13)
Detection and typing of herpes simplex viruses by using recombinant immunoglobulin fragments produced in bacteria (1997) (13)
Prevention of hepatitis C virus infection using a broad cross‐neutralizing monoclonal antibody (AR4A) and epigallocatechin gallate (2015) (13)
Cloning and expression of a human thyroglobulin autoantibody. (1991) (13)
Differences in the Binding Affinity of an HIV-1 V2 Apex-Specific Antibody for the SIVsmm/mac Envelope Glycoprotein Uncouple Antibody-Dependent Cellular Cytotoxicity from Neutralization (2019) (13)
The determination of molecular-motion parameters from proton-relaxation-enhancement measurements in a number of Gd(III) - antibody-fragment complexes. A comparative study. (1977) (13)
Broadly neutralizing antibodies to SARS-related viruses can be readily induced in rhesus macaques (2021) (13)
Systems Biology Methods Applied to Blood and Tissue for a Comprehensive Analysis of Immune Response to Hepatitis B Vaccine in Adults (2020) (13)
Glycosylation: disease targets and therapy. (2005) (12)
Massively scalable genetic analysis of antibody repertoires (2018) (12)
A pandemic-enabled comparison of discovery platforms demonstrates a naïve antibody library can match the best immune-sourced antibodies (2022) (12)
Antibodies in human infectious disease (2000) (12)
Toward superhuman SARS-CoV-2 immunity? (2020) (12)
Use of recombinant human antibody fragments for detection of cytomegalovirus antigenemia (1997) (11)
The chemoattractant des-Arg74-C5a regulates the expression of its own receptor on a monocyte-like cell line. (1986) (11)
Evolution of antibody immunity following Omicron BA.1 breakthrough infection (2022) (11)
A pseudovirus system enables deep mutational scanning of the full SARS-CoV-2 spike (2022) (11)
Human monoclonal antibodies: recent achievements. (1994) (11)
Variable region sequence of a human monoclonal thyroid peroxidase autoantibody. (1992) (11)
Optimization of peptide arrays for studying antibodies to hepatitis C virus continuous epitopes. (2014) (10)
Dengue Virus Evades AAV-Mediated Neutralizing Antibody Prophylaxis in Rhesus Monkeys. (2017) (10)
Differential processing of HIV envelope glycans on the virus and soluble recombinant trimer (2018) (10)
Structural Basis of Zika Virus Specific Neutralization in Subsequent Flavivirus Infections (2020) (10)
Novel in vitro booster vaccination to rapidly generate antigen-specific human monoclonal antibodies (2017) (10)
Glycans Function as Anchors for Antibodies and Help Drive HIV Broadly Neutralizing Antibody Development. (2017) (10)
HIV Broadly Neutralizing Antibodies: Taking Good Care Of The 98. (2016) (10)
Two-in-One Designer Antibodies (2009) (10)
Highly Attenuated Infection With a Vpr-Deleted Molecular Clone of Human Immunodeficiency Virus-1 (2018) (9)
Immunology. Square-dancing antibodies. (2007) (9)
An AIDS vaccine: no time to give up (2004) (9)
Oxygen breaks into carbon world (2006) (9)
Identification of peptides from human pathogens able to cross‐activate an HIV‐1‐gag‐specific CD4+ T cell clone (2006) (9)
Recruitment of actin to the cytoskeletons of human monocyte-like cells activated by complement fragment C5a. Is protein kinase C involved? (1988) (9)
Long-lasting germinal center responses to a priming immunization with continuous proliferation and somatic mutation (2021) (9)
Mamu-B*17+ Rhesus Macaques Vaccinated with env, vif, and nef Manifest Early Control of SIVmac239 Replication (2018) (9)
Toward a carbohydrate-based HIV-1 vaccine (2006) (9)
Human Immunodeficiency Virus type 1 elite neutralizers (2009) (9)
Therapeutic Neutralizing Monoclonal Antibodies: Report of a Summit sponsored by Operation Warp Speed and the National Institutes of Health (2020) (9)
Antibody responses induced by SHIV infection are more focused than those induced by soluble native HIV-1 envelope trimers in non-human primates (2021) (8)
Structural basis of broad HIV neutralization by a vaccine-induced cow antibody. (2020) (8)
The CCR5 receptor acts as an alloantigen in CCR5D32 homozygous individuals: Identification of chemokine- and HIV-1-blocking human antibodies (chemokine receptoryRANTESyallograft rejectionyHIV-1 neutralization) (1998) (8)
Reproducing SIV&Dgr;nef vaccine correlates of protection: trimeric gp41 antibody concentrated at mucosal front lines (2016) (8)
Correction: The Effects of Somatic Hypermutation on Neutralization and Binding in the PGT121 Family of Broadly Neutralizing HIV Antibodies (2013) (8)
Broadening a SARS-CoV-1 neutralizing antibody for potent SARS-CoV-2 neutralization through directed evolution (2021) (8)
Human monoclonal antibodies: achievement and potential. (1992) (8)
Review article: HCV ? STAT-C era of therapy (2010) (8)
Viral vaccines: past successes and future challenges. (2013) (8)
SnapShot: Broadly Neutralizing Antibodies (2013) (8)
Site directed mutagenesis of the complement C5a receptor--examination of a model for its interaction with the ligand C5a. (1994) (7)
Dissecting the neutralizing antibody specificities of broadly neutralizing sera from 1 HIV-1 infected donors 2 * (2007) (7)
Human antibodies to SARS-CoV-2 with a recurring YYDRxG motif retain binding and neutralization to variants of concern including Omicron (2022) (7)
Immune responses and HIV: a little order from the chaos (2006) (7)
Targeted protein S-nitrosylation of ACE2 inhibits SARS-CoV-2 infection (2022) (7)
Rapid cGMP manufacturing of COVID‐19 monoclonal antibody using stable CHO cell pools (2021) (7)
Proceedings of the Frontiers of Retrovirology Conference 2016 (2016) (7)
Molecular profile of a human monoclonal antibody Fab fragment specific for Epstein-Barr virus gp350/220 antigen. (2001) (7)
Correction: Novel in vitro booster vaccination to rapidly generate antigen-specific human monoclonal antibodies (2017) (7)
Amping up HIV antibodies (2021) (6)
Rectal Acquisition of Simian Immunodeficiency Virus (SIV) SIVmac239 Infection despite Vaccine-Induced Immune Responses against the Entire SIV Proteome (2020) (6)
Structural Basis for a Neutralizing Antibody Response Elicited by a Recombinant Hantaan Virus Gn Immunogen (2021) (6)
A new lease on life for an HIV-neutralizing antibody class and vaccine target (2021) (6)
Transplantation of a 17-amino acid alpha-helical DNA-binding domain into an antibody molecule confers sequence-dependent DNA recognition. (1995) (6)
Modulation of human DNA methyltransferase activity and mRNA levels in the monoblast cell line U937 induced to differentiate with dibutyryl cyclic AMP and phorbol ester. (1993) (6)
HIV: Immune memory downloaded (2009) (6)
Microassay for measurement of binding of radiolabelled ligands to cell surface molecules. (1988) (6)
A Plea for Justice for Jailed Medical Workers (2006) (5)
A welcome burst of human antibodies (2008) (5)
A novel CSP C-terminal epitope targeted by an antibody with protective activity against Plasmodium falciparum (2022) (5)
Comparisons of the antibody repertoires of a humanized rodent and humans by high throughput sequencing (2019) (5)
The generation of stable CHO cell lines expressing very high levels of complement C5A receptors and subsequent modulation of binding affinity for C5A. (1993) (5)
CRYSTAL STRUCTURE OF THE INTACT HUMAN IGG B12 WITH BROAD AND POTENT ACTIVITY AGAINST PRIMARY HIV-1 ISOLATES: A TEMPLATE FOR HIV VACCINE DESIGN (2001) (5)
Rapid Assay of Phage-Derived Recombinant Human Fabs As Bispecific Antibodies (1995) (5)
Antiacetylcholine Receptor Fab Fragments Isolated from Thymus‐derived Phage Display Libraries from Myasthenia Gravis Patients Reflect Predominant Specificities in Serum and Block the Action of Pathogenic Serum Antibodies (1998) (5)
Monoclonal Fab Fragments from Combinatorial Libraries Displayed on the Surface of Phage (1993) (5)
Immunochemical engineering of cell surfaces to generate virus resistance (2017) (5)
Correction: The Neonatal Fc Receptor (FcRn) Enhances Human Immunodeficiency Virus Type 1 (HIV-1) Transcytosis across Epithelial Cells (2013) (5)
Repertoire Cloning of Human Lupus Autoantibodies a (1995) (5)
A recurring YYDRxG pattern in broadly neutralizing antibodies to a conserved site on SARS-CoV-2, variants of concern, and related viruses (2021) (5)
Paramagnetic Ions as Relaxation Probes in Biological Systems (1980) (4)
Antibodies from Rabbits Immunized with HIV-1 Clade B SOSIP Trimers Can Neutralize Multiple Clade B Viruses by Destabilizing the Envelope Glycoprotein (2021) (4)
Elicitation of Neutralizing Antibodies Targeting the V2 Apex of the HIV Envelope Trimer in a Wild-Type Animal Model (2018) (4)
Broadly neutralizing anti-S2 antibodies protect against all three human betacoronaviruses that cause deadly disease (2023) (4)
Human Immunodeficiency Virus Type 1 Mutants That Escape Neutralization by Human Monoclonal Antibody IgG 1 b 12 (1997) (4)
Induction of Transient Virus Replication Facilitates Antigen-Independent Isolation of SIV-Specific Monoclonal Antibodies (2020) (4)
Accelerated Clearance and Degradation of Cell-Free HIV by Neutralizing Antibodies Occurs via FcγRIIb on Liver Sinusoidal Endothelial Cells by Endocytosis (2021) (4)
Expanded transition state analogues. (1991) (4)
A Rapid Assay for SARS-CoV-2 Neutralizing Antibodies That Is Insensitive to Antiretroviral Drugs (2021) (4)
Harnessing Activin A Adjuvanticity to Promote Antibody Responses to BG505 HIV Envelope Trimers (2020) (4)
Catalytic antibodies. (1989) (4)
Design of immunogens to elicit broadly neutralizing antibodies against HIV targeting the CD4 binding site (2021) (4)
Antibody recognition of a carbohydrate epitope: a template for HIV vaccine design. (2005) (4)
Swift antibodies to counter emerging viruses (2015) (4)
Structure and Function of Immunoglobulins (1986) (3)
Crystal structure of the trimeric prefusion Ebola virus glycoprotein in complex with a neutralizing antibody from a human survivor (2008) (3)
CHAPTER 26 – The nature of the interaction of bacterial Fc receptors and IgG (1990) (3)
Targeted isolation of panels of diverse human protective broadly neutralizing antibodies against SARS-like viruses (2021) (3)
Antibody-based Protection Against HIV Infection (2014) (3)
Taking down defenses to improve vaccines (2018) (3)
Correction for Doores et al., Two Classes of Broadly Neutralizing Antibodies within a Single Lineage Directed to the High-Mannose Patch of HIV Envelope (2015) (3)
Structural Constraints Det ermine the Glycosylation of HIV-1 Envelope Trimers Graphical (2015) (3)
Enhanced Ability of Plant-Derived PGT121 Glycovariants To Eliminate HIV-1-Infected Cells (2021) (3)
Author Correction: A Engineered immunogen binding to alum adjuvant enhances humoral immunity (2020) (3)
Phage display. (1995) (3)
Publisher Correction: Recent progress in broadly neutralizing antibodies to HIV (2019) (3)
Proton relaxation enhancement to probe the effects of antigen binding on pig antibody structure (1979) (3)
Vaccine-induced protection from homologous Tier 2 simian-human immunodeficiency virus challenge in nonhuman primates (2018) (3)
Correction: Minimally Mutated HIV-1 Broadly Neutralizing Antibodies to Guide Reductionist Vaccine Design (2016) (3)
Antibody engineering and therapeutics conference (2014) (3)
An unfinished quest (2001) (3)
REQUIRED TEXTBOOKS - IMMUNOLOGY (2011) (3)
Antibody barriers to going viral (2019) (2)
Differential binding of neutralizing and non-neutralizing antibodies to native-like soluble HIV-1 Env trimers, uncleaved Env proteins, and monomeric subunits (2014) (2)
Author Correction: Vaccine elicitation of HIV broadly neutralizing antibodies from engineered B cells (2020) (2)
Engineering SARS-CoV-2 neutralizing antibodies for increased potency and reduced viral escape pathways (2022) (2)
HIV-1 Vpu restricts Fc-mediated effector functions in vivo (2022) (2)
Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope (2004) (2)
Comprar Annals of the New York Academy of Sciences, Volume 1039, Clinical and Basic Oculomotor Research: In Honor of David S. Zee | Peter Delves | 9781573315661 | Wiley (2009) (2)
Identification of IOMA-class neutralizing antibodies targeting the CD4-binding site on the HIV-1 envelope glycoprotein (2022) (2)
23Na NMR as a probe of ion binding to chromatin (1978) (2)
Author Correction: A pandemic-enabled comparison of discovery platforms demonstrates a naïve antibody library can match the best immune-sourced antibodies (2022) (2)
Chimpanzee SIV Envelope trimer: structure and deployment as an HIV vaccine template (2018) (2)
Antibody Engineering & Therapeutics 2016: The Antibody Society's annual meeting, December 11–15, 2016, San Diego, CA (2015) (2)
Lanthanide Ions as Probes in Antibodies (1978) (2)
Human Immunodeﬁciency Virus Type 1 Elite Neutralizers: Individuals with Broad and Potent Neutralizing Activity Identiﬁed by Using a High-Throughput Neutralization Assay together with an Analytical Selection Algorithm (cid:1) † (2009) (2)
A broad and potent neutralization epitope in SARS-related coronaviruses (2022) (1)
Acknowledgment of Guest Editors, 2019 (2019) (1)
Characterization of a monoclonal antibody recognizing a novel leucocyte adhesion molecule. (1990) (1)
Antibody Engineering & Therapeutics 2015: The Antibody Society's annual meeting December 7–10, 2015, San Diego, CA (2015) (1)
Joseph Jardine Receptors Rational HIV Immunogen Design to Target Specific Germline B Cell (2013) (1)
Erratum: Human monoclonal antibodies against a plethora of viral pathogens from single combinatorial libraries (Proceedings of the National Academy of Sciences of the United States of America (May 1, 1993) 90:9 (4141-4145)) (1994) (1)
Neutralizing HIV Antibody 4E10 Cells in Knock-In Mice Expressing Broadly Immune Tolerance Negatively Regulates B (2013) (1)
Enhanced IgG Hexamerization Mediates Efficient C1q Docking and Complement-Dependent Cytotoxicity; Preclinical Proof Of Concept On Primary CLL and Burkitt Lymphoma (2013) (1)
Erratum: Copper has differential effect on prion protein with polymorphism of position 129 (Biochemical and Biophysical Research Communications (2000) 269, 3 (726-731)) (2000) (1)
Initial characterization of an anti-actin monoclonal antibody (NH3) (1988) (1)
Catalytic antibodies-designer enzymes (1990) (1)
Protein engineering structure and design, prediction and evolution: cycling to success (1998) (1)
Neutralizing antibody responses to an HIV envelope glycan hole are not easily broadened (2019) (1)
Therapeutic neutralizing monoclonal antibody administration protects against lethal Yellow Fever infection (2022) (1)
The Effects of an mRNA Covid-19 Vaccine Booster on Immune Responses in Cancer-Bearing Veterans (2022) (1)
Importance of anti-HIV-1 antibodies (1997) (1)
The Cambrian Conundrum: Early Divergence and Later Ecological Success in the Early History of Animals (2011) (1)
Autologous neutralizing antibody responses to an HIV envelope glycan hole are not easily broadened in rabbits. (2020) (1)
Crystal structure of human Fab PGDM1400, a broadly reactive and potent HIV-1 neutralizing antibody (2013) (1)
Guiding the evolution to catch the virus: An in silico study of affinity maturation against rapidly mutating antigen (2014) (1)
Tissue resident memory T cells trigger rapid exudation and local antibody accumulation. (2023) (1)
Replication after Repeated Low Dose Heterologous SIV Challenge 2 (2010) (1)
Longitudinally Tracked, Rapid and Robust Antigen-Specific Germinal Center Responses in Non-Human Primates after a Single Nanoparticle Vaccine Immunization (2019) (1)
IgG hexamerization mediates efficient C1q docking and complement-dependent cytotoxicity (CDC) (2013) (1)
Human autoantibody recognition of DNA ( systemic lupus erythematosus / phage display / antibody libraries ) (2005) (1)
Fab fragments isolated from thymus of myasthenia gravis patients reflect predominant specificities in serum and block the action of serum antibodies (1997) (0)
HIV-1 gp120 Envelope Glycoprotein (T257S, S334A, S375W) Complexed with CD4 and Antibody 17b (2007) (0)
Structure of the trimeric prefusion Ebola virus GP complexed with an antibody from a human survivor (2008) (0)
HIV-1 gp120 Envelope Glycoprotein(S334A) Complexed with CD4 and Antibody 17b (2007) (0)
Commonality despite exceptional diversity in the baseline human antibody repertoire (2019) (0)
Crystal structure of HIV-gp120 core in complex with CD4-binding site antibody b13, space group C2221 (2009) (0)
Cell-stored SARS-CoV-2 spike variant libraries Produce pseudovirus-based full spike deep mutational scanning libraries (2023) (0)
Antibodies as Therapeutic Agents for Prion Disease (2003) (0)
IN VIVO PROTECTION AGAINST HCV BY BROADLY NEUTRALIZING HUMAN MONOCLONAL ANTIBODIES: 180 (2008) (0)
Deviation from standard dose-response curve by bnMAbs in a U87 target cell assay. (2015) (0)
Mechanisms of escape from the PGT128 family of anti-HIV broadly neutralizing antibodies (2016) (0)
Anticorps diriges contre le virus dengue, compositions, methodes et utilisations correspondantes (2004) (0)
Advancing an HIV vaccine; advancing vaccinology (2018) (0)
The chemoattractant des-Arg 74-C 5 a regulates the expression of its own receptor on a monocyte-like cell line (2005) (0)
Neutralizing antibodies are selected against hiv with a broad cross-reactive, the receptor complex with the help of env cd4-co- (2002) (0)
Antibodies as anti-virals (2007) (0)
Crystal structure of hiv-1 neutralizing human fab 4e10 in complex with a 16-residue peptide encompassing the 4e10 epitope on gp41 (2005) (0)
Toward Human Monoclonal Antibodies (1990) (0)
Chapter 9 An HIV elite neutralizer as a blueprint for the induction of neutralizing antibodies (2016) (0)
Antiviral neutralizing antibodies: from in vitro to in vivo activity. (2023) (0)
Broadly neutralizing antibodies targeting a conserved silent face of spike RBD resist extreme SARS-CoV-2 antigenic drift (2023) (0)
Recombinant human neutralizing antibodies to HIV-1 (1994) (0)
The Human Immunodeﬁciency Virus Type 1 Envelope Spike of Primary Viruses Can Suppress Antibody Access to Variable Regions (cid:1) (2009) (0)
The Molecular Basis of the Interaction of Immunoglobulin G with Complement and Phagocytic Cells (1988) (0)
Crystal structure of hiv-1 neutralizing human fab 4e10 in complex with a thioether-linked peptide encompassing the 4e10 epitope on gp41 (2006) (0)
Proceedings of the Frontiers of Retrovirology Conference 2016 (2016) (0)
Early Antibody Lineage Di versification and Independent Limb Maturation Lead to Broad HIV-1 Neutralization Targeting the Env High-Mannose Patch Graphical (2016) (0)
Isolation of Cross-Clade HIV-Neutralizing Human Antibodies from Memory B Cell Repertoires Using Short Term Culture and High-Throughput Primary Neutralization Screens (38.17) (2010) (0)
Complementary antibody lineages achieve neutralization breadth in an HIV-1 infected elite neutralizer (2022) (0)
Enhanced IgG hexamerization mediates efficient C1q docking and more rapid and substantial complement-dependent cytotoxicity; preclinical proof of concept (2014) (0)
LESGGGWQPGRSLRLSCAASGFTFR TYGMH WVRQAPGKGLEWVA VISYDGSKNYYADSVKG RFTISRDNSKKTLYLQMNSLRAEDTAVYYCAK DFWSGSTKNVFDL GLCHV 14 , LEQSGGGVVQPGRSLRLSCAASGFTFR TYGMH WVRQAPGKGLEWVA VISYDGSKNYYADSVKG RFTISRDNSKKTLYLQMNSLRAEDTAVYYCAK DFWSGSTKNVFDL GLCMV 12 LEQSGAELKRPWSSVKVSCKASGGTLR STAVN WVRQPPGQGLEWMGG LIPL (0)
Virus Type 1 Isolates of Human Immunodeficiency Antibody Neutralization-Resistant Primary (1998) (0)
Novel antibodies with broad neutralizing power of HIV-1 (2011) (0)
Mechanisms and in-vivo Significance of HIV-1 Neutralisation (2000) (0)
Moving closer to a mouse model for hepatitis C (2009) (0)
Overline : Emerging infections One Sentence Summary : Neutralizing antibodies prevent Zika infection (0)
Synthesis of Fluorinated a-Pyrans (2009) (0)
Amping up HIV antibodies High serum titers of neutralizing antibody can protect humans against HIV (2021) (0)
542. DNA shuffling generates novel HIV-1 envelope variants that can induce broadly neutralizing antibodies in rabbits (2004) (0)
Correction for Khan et al., “Targeting the HIV-1 Spike and Coreceptor with Bi- and Trispecific Antibodies for Single-Component Broad Inhibition of Entry” (2019) (0)
Fetal demise and failed antibody therapy during Zika virus infection of pregnant macaques (2018) (0)
HIV-1 gp120 Envelope Glycoprotein (M95W, W96C, T257S, V275C, S334A, S375W, A433M) Complexed with CD4 and Antibody 17b (2007) (0)
CRYSTAL STRUCTURE OF THE ANTI-PRION FAB 3F4 IN COMPLEX WITH ITS PEPTIDE EPITOPE (2000) (0)
Lipid Binding: A Necessary Evil for Broadly Neutralizing Anti-gp41 Antibodies? (2008) (0)
Structure of HIV-1 gp120 (core with V3) in Complex with CD4-Binding-Site Antibody F105 (2009) (0)
Monoclonal antibody UJ 127 . 11 recognizes the human homologue of mouse L 1 cell adhesion molecule (2009) (0)
HIV-1-CD4-coreceptor interactions in virus binding and neutralization (1998) (0)
Structure-based design of native-like HIV-1 envelope trimers to silence non-neutralizing epitopes and eliminate CD4 binding (2017) (0)
1 Cross-reactive serum and memory B cell responses to spike protein in SARS-CoV- 2 2 and endemic coronavirus infection 3 (2020) (0)
Disease Prevention Accelerating Next-Generation Vaccine Development for Global (2013) (0)
FAB 2G12 unliganded (2003) (0)
Deep repertoire mining uncovers ultra-broad coronavirus neutralizing antibodies targeting multiple spike epitopes (2023) (0)
New applications for antibodies (1990) (0)
FAB 2G12 + Man5 (2005) (0)
Dissecting the Neutralizing Antibody Speciﬁcities of Broadly Neutralizing Sera from Human Immunodeﬁciency Virus Type 1-Infected Donors (cid:1) (2007) (0)
HIV-1 gp120 Envelope Glycoprotein Complexed with the Broadly Neutralizing CD4-Binding-Site Antibody b12 (2007) (0)
Crystal structure of an unbound KZ52 neutralizing anti-Ebolavirus antibody. (2009) (0)
Determinants Flanking the CD4 Binding Loop Modulate Macrophage Tropism of Human Immunodeﬁciency Virus Type 1 R5 Envelopes (cid:1) † (2009) (0)
HIV-1 gp120 Envelope Glycoprotein (I109C, T257S, S334A, S375W, Q428C) Complexed with CD4 and Antibody 17b (2007) (0)
Introductory article for Immunological Reviews, Vol 310 (2022) (0)
Human neutralizing monoclonal antibody against the immunodeficiency produced struggling virus in humans (1993) (0)
Author Correction: Long-primed germinal centres with enduring affinity maturation and clonal migration (2023) (0)
The diversity of the glycan shield of sarbecoviruses closely related to SARS-CoV-2 (2022) (0)
Combinatorial Phage Antibody Libraries (2006) (0)
Cryo-EM structure of Zika virus in complex with E protein cross-linking human monoclonal antibody ADI30056 (2020) (0)
Conformational Dynamics of Single HIV-1 Envelope Proteins on the Surface of Native Virions (2015) (0)
Immunodeficiency Virus Variants of Simian-Human Characterization of Primary Isolate-Like (1999) (0)
Inhibition of HIV Env binding to cellular receptors by monoclonal antibody 2G12 as probed by Fc-tagged gp120 (2007) (0)
HIV-1 gp120 Envelope Glycoprotein (M95W, W96C, I109C, T123C, T257S, V275C,S334A, S375W, Q428C, G431C) Complexed with CD4 and Antibody 17b (2007) (0)
Comparisons of the antibody repertoires of a humanized rodent and humans by high throughput sequencing (2020) (0)
Publisher Correction: Recent progress in broadly neutralizing antibodies to HIV (2019) (0)
Probing an HIV-1 virion library containing randomly recombined clade B envelope glycoproteins reveals a surprising diversity of phenotypes (2010) (0)
1146 THE EFFECTS OF BROADLY NEUTRALIZING ANTIBODIES IN EXPERIMENTAL HCV INFECTION (2013) (0)
Promotion of the neutralization-competent structure of the HIV-1 gp41 membrane proximal external region when tethered to its native transmembrane domain, and expressed in the context of the plasma membrane: implications for vaccine design (53.24) (2011) (0)
Author Correction: A Engineered immunogen binding to alum adjuvant enhances humoral immunity (2020) (0)
Crystal structure of PG9 light chain (2010) (0)
The structure of immunoglobulins and their interaction with complement (1993) (0)
Erwin Success in the Early History of Animals The Cambrian Conundrum : Early Divergence and Later Ecological (2011) (0)
infection Broadly neutralizing antibodies abrogate established hepatitis C virus (2014) (0)
IgA Antibodies Carrying the b12 V Regionand Cell Transfer by Human Monoclonal IgG Inhibition of HIV-1 Infectivity and Epithelial (2007) (0)
Resource Elicitation of Robust Tier 2 Neutralizing Antibody Responses in Nonhuman Primates by HIV Envelope Trimer Immunization Using Optimized Approaches Graphical Abstract Highlights (0)
Molecular basis of antibody effector function. (1988) (0)
Morals and Markets (2013) (0)
Recent progress in broadly neutralizing antibodies to HIV (2018) (0)
Effect of copper on recombinant mouse prion protein (2000) (0)
984. Directed Molecular Evolution Generates Novel HIV-1 Envelope Variants That Can Elicit Broadly Neutralizing Antibody Responses in Rabbits (2005) (0)
Eliciting broadly neutralizing antibodies to human immunodeficiency virus could bring closer the goal of a successful AIDS vaccine. Here the International AIDS Vaccine Initiative Neutralizing Antibody Consortium discusses current approaches to overcome the problems faced. (2004) (0)
Characterization of a monoclonal antibody (DA1) which reacts with bone matrix and bone cell cytoplasm (1987) (0)
HUMAN Fcγ EPITOPES AND INTERACTION SITES FOR EFFECTOR MOLECULES (1987) (0)
Viral subversion of humoral immune responses. (2006) (0)
A case for research consortia to accelerate vaccine candidate discovery: identification of a stable antigenic HIV-1 Clade A Env candidate (P6370) (2013) (0)
Approaches to the neutralizing antibody problem in HIV vaccine design (2003) (0)
The Localization of Effector Sites on Immunoglobulin G (1983) (0)
Koff, W.C. et al. HIV vaccine design: insights from live attenuated SIV vaccines. Nat. Immunol. 7, 19-23 (2006) (0)
Preexposure passive transfer predicts plasma antibody levels prevent HIV-I aquisition (2014) (0)
HIV-1 gp120 Envelope Glycoprotein (K231C, T257S, E267C, S334A, S375W) Complexed with CD4 and Antibody 17b (2007) (0)
The activity of a potent neutralizing human antibody against primary isolates in vivo (1998) (0)
Chimpanzee SIV Env trimeric ectodomain. (2019) (0)
Neutralizing antibodies to human immunodeficiency virus (HIV) (2010) (0)
MINIREVIEW Genetic Subtypes, Humoral Immunity, and Human Immunodeﬁciency Virus Type 1 Vaccine Development (2001) (0)
Construction of a phage display antibody library against platelet α-granules. selection of recombinant antibodies against type 1 plasminogen activator inhibitor (PAI-1) (1994) (0)
Targeted isolation of diverse human protective broadly neutralizing antibodies against SARS-like viruses (2022) (0)
Current Topics in Microbiology and Immunology (1977) (0)
Responses to the Smallpox Vaccine Resistance Revealed in Human Antibody (2014) (0)
Neutralizing Antibodies Afforded by Passive Infusion of Does Not Augment the Sterile Protection Immunodeficiency Virus DNA Vaccination Immunodeficiency Virus Type 1 / Simian Cellular Immunity Elicited by Human (2003) (0)
A pseudovirus system enables deep mutational scanning of the full SARS-CoV-2 spike (2023) (0)
A method for detecting respiratory syncytial virus (2002) (0)
Molecular insights into antibody-mediated protection against the prototypic simian immunodeficiency virus (2021) (0)
Transplantation of a 17-amino acid a-helical DNA-binding domain into an antibody molecule confers sequence-dependent DNA recognition ( DNA-binding antibodies / recombinant antibodies / transcription factors / basic helix-loop-helix protein / TFEB ) (2005) (0)
HIV-1 gp120 Envelope Glycoprotein (M95W, W96C, I109C, T257S, V275C, S334A, S375W, Q428C, A433M) Complexed with CD4 and Antibody 17b (2007) (0)
A meta-analysis of passive immunization studies shows an association of serum neutralizing antibody titer with protection against SHIV challenge (2019) (0)
Characterization of the antibody response to HIV-1 envelope (1997) (0)
Corrigendum to “A robust, high-throughput assay to determine the phagocytic activity of clinical antibody samples” (2012) (0)
Highly Antigenically Diverse Viruses Broadly Neutralizing Antibodies Present New Prospects to Counter (2012) (0)
A Germline-Targeting Chimpanzee SIV Envelope Glycoprotein Elicits a New Class of V2-Apex Directed Cross-Neutralizing Antibodies (2022) (0)
Studies on the third variable domain of human immunodeficiency virus type-1 envelope protein (1999) (0)
Measurement of the W gamma and Z gamma inclusive cross sections in pp collisions at root s=7 TeV and limits on anomalous triple gauge boson couplings (2014) (0)
Title Neutralizing Polyclonal IgG Present during Acute Infection Prevents Rapid Disease Onset in Simian-Human Immunodeficiency Virus SHIV SF 162 P 3-Infected Infant Rhesus Macaques Permalink (2013) (0)
Targeted protein S-nitrosylation of ACE2 as potential treatment to prevent spread of SARS-CoV-2 infection (2022) (0)
Glycans Function as Ancho rs for Antibodies andHelp Drive HIV Broadly Neutralizing Antibody Development Graphical (2017) (0)
Helical Peptide Analogs of gp41 to Develop an HIV Vaccine (2006) (0)
16 Antibodies as Tools to Probe Prion Protein Biology (1999) (0)
Immunopolypeptides diriges contre le virus de l'hepatite c (2002) (0)
An Automated Fluorescence-Based Method to Isolate Bone Marrow-Derived Plasma Cells from Rhesus Macaques Using SIVmac239 SOSIP.664 (2020) (0)
The monocyte binding domain(s) on human immunoglobulin G. (1984) (0)
Anti-HIV-1 Antibodies and CD 4-IgG Breadth and Potency of Neutralization of Antibody Conjugation Approach Enhances (2013) (0)
HIV-1 gp120 Envelope Glycoprotein (K231C, T257S, E268C, S334A, S375W) Complexed with CD4 and Antibody 17b (2007) (0)
Access of antibody molecules to th conserved coreceptor binding site on glycoprotein gp120 is sterically restricted on primary HIV-1 (2009) (0)
Crystal Structure of Fab 2G12 bound to Man9GlcNAc2 (2003) (0)
Design clues from functional constraints and broadly neutralizing antibodies (2006) (0)
Neutralizing monoclonal antibodies to human respiratory syncytial virus. (1993) (0)
Immunology in focus (set of three videos): edited by A. Johnstone, J. Kay, L. Steiner and S. King, IRL Press, 1988. $695.00/£350.000 (+VAT in UK) (approx. 20 min each) (1989) (0)
PP 8.2 – 00015 Retargeting cytomegalovirus-specific CD8+ cytotoxic T lymphocytes to kill HIV/SIV-infected cells via peptide-MHC Iantibody fusion proteins (2022) (0)
Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution (2004) (0)
The diversity of the glycan shield of sarbecoviruses related to SARS-CoV-2 (2023) (0)
Immunoglobulin G subclass specificity of human Fc receptor II determined using human chimeric anti-5-iodio-4-hydroxy-3-nitrophenacetyl monoclonal antibodies (1988) (0)
Basic and clinical aspects of IgG subclasses: structure and function (1986) (0)
Engineered immunogen binding to alum adjuvant enhances humoral immunity (2020) (0)
Fab 2G12 + Man8 (2005) (0)
Antibodies from convalescent plasma protect against COVID-19 (2020) (0)
HIV-1 escapes from N332-directed antibody neutralization in an elite neutralizer by envelope glycoprotein elongation and introduction of unusual disulfide bonds (2016) (0)
THE HIV VACCINE PROBLEM : WHY HAVE PAST APPROACHES TO DEVELOP AN HIV VACCINE FAILED ? (0)
Steering antibody evolution to combat rapidly mutating pathogens (2015) (0)
Suger and spice (1991) (0)
IBCL-054 The Effects of an mRNA COVID-19 Vaccine Booster on Immune Responses in Cancer-Bearing Veterans (2022) (0)
1 and Function of Immunoglobulins (1986) (0)
Process for the production of human monoclonal antibodies (1995) (0)
CRYSTAL STRUCTURE OF THE ANTI-PRION FAB 3F4 (2000) (0)
Crystal Structure of Fab 2G12 bound to Man1->2Man (2003) (0)
Synthetic human neutralizing monoclonal antibodies to HIV (1994) (0)

This paper list is powered by the following services:

Other Resources About Dennis Burton

en.wikipedia.org

What Schools Are Affiliated With Dennis Burton ?

Dennis Burton is affiliated with the following schools:

Dennis Burton 's Academic­Influence.com Rankings

Why Is Dennis Burton Influential?

Dennis Burton 's Published Works

Published Works

Other Resources About Dennis Burton

What Schools Are Affiliated With Dennis Burton ?

Dennis Burton 's AcademicInfluence.com Rankings