Linda Partridge

Q: What Schools Are Affiliated With Linda Partridge

Linda Partridge is affiliated with the following schools: University of Sheffield, University of Oxford, University College London, University of Edinburgh, University of New Mexico

Linda Partridge's AcademicInfluence.com Rankings

Linda Partridge

Biology

#747

World Rank

#1295

Historical Rank

Developmental Biology

#21

World Rank

#24

Historical Rank

Genetics

#94

World Rank

#129

Historical Rank

biology Degrees

Download Badge

Biology

Why Is Linda Partridge Influential?

(Suggest an Edit or Addition)

According to Wikipedia, Professor Dame Linda Partridge is a British geneticist, who studies the biology and genetics of ageing and age-related diseases, such as Alzheimer's disease and Parkinson's disease. Partridge is currently Weldon Professor of Biometry at the Institute of Healthy Ageing, Research Department of Genetics, Evolution and Environment, University College London, and Founding Director of the Max Planck Institute for the Biology of Ageing in Cologne, Germany.

(See a Problem?)

Linda Partridge's Published Works

Number of citations in a given year to any of this author's works

Total number of citations to an author for the works they published in a given year. This highlights publication of the most important work(s) by the author

Published Works

The Hallmarks of Aging (2013) (9261)
Extending Healthy Life Span—From Yeast to Humans (2010) (2519)
Extension of Life-Span by Loss of CHICO, a Drosophila Insulin Receptor Substrate Protein (2001) (1377)
Cost of mating in Drosophila melanogaster females is mediated by male accessory gland products (1995) (1312)
Ageing as a Risk Factor for Disease (2012) (1090)
Ribosomal Protein S6 Kinase 1 Signaling Regulates Mammalian Life Span (2009) (1034)
Promoting Health and Longevity through Diet: From Model Organisms to Humans (2015) (905)
Mechanisms of Life Span Extension by Rapamycin in the Fruit Fly Drosophila melanogaster (2010) (893)
Longer lifespan, altered metabolism, and stress resistance in Drosophila from ablation of cells making insulin-like ligands. (2005) (759)
Oxford Surveys in Evolutionary Biology (1991) (726)
Amino acid imbalance explains extension of lifespan by dietary restriction in Drosophila (2009) (661)
Unraveling the biological roles of reactive oxygen species. (2011) (653)
Absence of effects of Sir2 over-expression on lifespan in C. elegans and Drosophila (2011) (606)
Optimally, mutation and the evolution of ageing (1993) (601)
C9orf72 repeat expansions cause neurodegeneration in Drosophila through arginine-rich proteins (2014) (569)
Genome-Wide Transcript Profiles in Aging and Calorically Restricted Drosophila melanogaster (2002) (562)
Molecular Evolution and Functional Characterization of Drosophila Insulin-Like Peptides (2010) (539)
Facing up to the global challenges of ageing (2018) (538)
Genetic ablation of the t-SNARE SNAP-25 distinguishes mechanisms of neuroexocytosis (2002) (532)
Demography of Dietary Restriction and Death in Drosophila (2003) (531)
A cost of mating in female fruitflies (1989) (518)
Evidence for lifespan extension and delayed age–related biomarkers in insulin receptor substrate 1 null mice (2008) (512)
The Ecological Context of Life History Evolution (1988) (502)
Calories Do Not Explain Extension of Life Span by Dietary Restriction in Drosophila (2005) (501)
Cardioprotection by S-nitrosation of a cysteine switch on mitochondrial complex I (2013) (497)
Genetics of longevity in model organisms: debates and paradigm shifts. (2013) (489)
Sexual conflict and speciation. (1998) (476)
The sex peptide of Drosophila melanogaster: Female post-mating responses analyzed by using RNA interference (2003) (474)
Effects of resveratrol on lifespan in Drosophila melanogaster and Caenorhabditis elegans (2007) (450)
Female fitness in Drosophila melanogaster: an interaction between the effect of nutrition and of encounter rate with males (1996) (450)
Long-Lived Drosophila with Overexpressed dFOXO in Adult Fat Body (2004) (443)
Sex and Death: What Is the Connection? (2005) (442)
Stress-response hormesis and aging: "that which does not kill us makes us stronger". (2008) (439)
Signaling by IL-6 promotes alternative activation of macrophages to limit endotoxemia and obesity-associated resistance to insulin (2014) (428)
Mechanisms of aging: public or private? (2002) (424)
EVOLUTION AND DEVELOPMENT OF BODY SIZE AND CELL SIZE IN DROSOPHILA MELANOGASTER IN RESPONSE TO TEMPERATURE (1994) (409)
Sexual activity reduces lifespan of male fruitflies (1981) (363)
Dietary restriction in Drosophila (2005) (352)
The interaction between FOXO and SIRT1: tipping the balance towards survival. (2004) (339)
DIRECT AND CORRELATED RESPONSES TO SELECTION ON AGE AT REPRODUCTION IN DROSOPHILA MELANOGASTER (1992) (326)
Lifetime mating success of male fruitflies (Drosophila melanogaster) is related to their size (1983) (317)
Male size and mating success in Drosophila melanogaster and D. pseudoobscura under field conditions (1987) (304)
A Drosophila Insulin-like Peptide Promotes Growth during Nonfeeding States (2009) (299)
Dietary Restriction in Long-Lived Dwarf Flies (2002) (299)
Superoxide and hydrogen peroxide production by Drosophila mitochondria. (2003) (296)
Localization of the binding site for the human high-affinity Fc receptor on IgG (1988) (291)
Effects of egg-production and of exposure to males on female survival in Drosophila melanogaster (1987) (288)
Mechanisms of ageing: public or private? (2002) (287)
Calcium-activated non-specific cation channels (1988) (282)
Optimization of dietary restriction protocols in Drosophila. (2007) (280)
A delayed wave of death from reproduction in Drosophila. (1999) (269)
Measurement of H2O2 within Living Drosophila during Aging Using a Ratiometric Mass Spectrometry Probe Targeted to the Mitochondrial Matrix (2011) (266)
Role of insulin-like signalling in Drosophila lifespan. (2007) (262)
Cellular basis and developmental timing in a size cline of Drosophila melanogaster. (1995) (259)
A holidic medium for Drosophila melanogaster (2013) (257)
Courtship reduces longevity of male Drosophila melanogaster (1996) (252)
Ageing in Drosophila: The role of the insulin/Igf and TOR signalling network (2011) (251)
Genetic and environmental responses to temperature of Drosophila melanogaster from a latitudinal cline. (1997) (235)
Male size and mating success in Drosophila melanogaster: the roles of male and female behaviour (1987) (234)
Sex differences in the effect of dietary restriction on life span and mortality rates in female and male Drosophila melanogaster. (2004) (231)
Interactions of mating, egg production and death rates in females of the Mediterranean fruitfly, Ceratitis capitata (1998) (231)
Insulin/IGF-like signalling, the central nervous system and aging. (2009) (224)
Quantification of Food Intake in Drosophila (2009) (223)
Evolutionary conservation of regulated longevity assurance mechanisms (2007) (212)
Limits to natural selection (2000) (206)
Autophagy in healthy aging and disease (2021) (205)
Mate choice increases a component of offspring fitness in fruit flies (1980) (205)
Evolutionary Responses of the Life History of Wild‐Caught Drosophila melanogaster to Two Standard Methods of Laboratory Culture (2000) (205)
THERMAL SENSITIVITY OF DROSOPHILA MELANOGASTER RESPONDS RAPIDLY TO LABORATORY NATURAL SELECTION (1991) (204)
Another set of responses and correlated responses to selection on age at reproduction in Drosophila melanogaster (1999) (200)
BERGMANN'S RULE IN ECTOTHERMS: IS IT ADAPTIVE? (1997) (197)
dFOXO-independent effects of reduced insulin-like signaling in Drosophila (2011) (196)
Reduction of DILP2 in Drosophila Triages a Metabolic Phenotype from Lifespan Revealing Redundancy and Compensation among DILPs (2008) (188)
The quest to slow ageing through drug discovery (2020) (186)
Sex and conflict. (1998) (184)
Insulin/IGF signalling and ageing: seeing the bigger picture. (2001) (179)
Genome-wide gene expression in response to parasitoid attack in Drosophila (2005) (175)
Dietary restriction and aging: a unifying perspective. (2011) (174)
A comparison of the genetic basis of wing size divergence in three parallel body size clines of Drosophila melanogaster. (1999) (170)
Separating cause from effect: how does insulin/IGF signalling control lifespan in worms, flies and mice? (2008) (169)
THERMAL EVOLUTION OF EGG SIZE IN DROSOPHILA MELANOGASTER (1996) (168)
Activation of AMPK by the Putative Dietary Restriction Mimetic Metformin Is Insufficient to Extend Lifespan in Drosophila (2012) (167)
Small nucleoli are a cellular hallmark of longevity (2017) (164)
Inhibition of GSK-3 Ameliorates Aβ Pathology in an Adult-Onset Drosophila Model of Alzheimer's Disease (2010) (163)
Constraints in the Evolution of Life Histories (1991) (162)
Interleukin-6 signaling promotes alternative macrophage activation to limit obesity-associated insulin resistance and endotoxemia (2014) (162)
Human monoclonal antibodies against a plethora of viral pathogens from single combinatorial libraries. (1993) (162)
Non-mating costs of exposure to males in female Drosophila melanogaster (1990) (161)
Life‐History Consequences of Egg Size in Drosophila Melanogaster (1997) (159)
RAPID LOSS OF STRESS RESISTANCE IN DROSOPHILA MELANOGASTER UNDER ADAPTATION TO LABORATORY CULTURE (2001) (157)
Thermal evolution of rate of larval development in Drosophila melanogaster in laboratory and field populations (1995) (156)
Signal-handling characteristics of load-moving skeletal muscle. (1966) (156)
Endocrine regulation of aging and reproduction in Drosophila (2009) (155)
RESPONSES AND CORRELATED RESPONSES TO ARTIFICIAL SELECTION ON THORAX LENGTH IN DROSOPHILA MELANOGASTER (1993) (155)
Sex difference in pathology of the ageing gut mediates the greater response of female lifespan to dietary restriction (2016) (155)
Branched-chain amino acids impact health and lifespan indirectly via amino acid balance and appetite control (2019) (155)
On measuring the rate of ageing (1996) (154)
Dietary restriction protects from age-associated DNA methylation and induces epigenetic reprogramming of lipid metabolism (2017) (153)
Role of dFOXO in lifespan extension by dietary restriction in Drosophila melanogaster: not required, but its activity modulates the response (2008) (153)
The Ras-Erk-ETS-Signaling Pathway Is a Drug Target for Longevity (2015) (153)
The role of male accessory gland protein Acp36DE in sperm competition in Drosophila melanogaster (2000) (152)
The new biology of ageing (2010) (149)
Dietary Restriction in Drosophila: Delayed Aging or Experimental Artefact? (2007) (149)
Insulin signaling is necessary for vitellogenesis in Drosophila melanogaster independent of the roles of juvenile hormone and ecdysteroids: female sterility of the chico1 insulin signaling mutation is autonomous to the ovary. (2005) (148)
Evolutionary biology: Costs of reproduction (1985) (147)
G‐quadruplex‐binding small molecules ameliorate C9orf72 FTD/ALS pathology in vitro and in vivo (2017) (147)
New model of health promotion and disease prevention for the 21st century (2008) (144)
WHY IT IS DIFFICULT TO MODEL SPERM DISPLACEMENT IN DROSOPHILA MELANOGASTER: THE RELATION BETWEEN SPERM TRANSFER AND COPULATION DURATION (2000) (143)
Thermal evolution of ectotherm body size: why get big in the cold? (1996) (143)
Metabolic rate is not reduced by dietary-restriction or by lowered insulin/IGF-1 signalling and is not correlated with individual lifespan in Drosophila melanogaster (2004) (142)
Thermal Sensitivity of Drosophila melanogaster: Evolutionary Responses of Adults and Eggs to Laboratory Natural Selection at Different Temperatures (1997) (141)
Feeding, fecundity and lifespan in female Drosophila melanogaster (2008) (139)
An examination of the effects of males on the survival and egg-production rates of female Drosophila melanogaster . (1986) (137)
Horizons in the evolution of aging (2018) (136)
The effects of exogenous antioxidants on lifespan and oxidative stress resistance in Drosophila melanogaster (2006) (136)
Mating patterns and mate choice (1984) (135)
Evolutionary Biology (2nd edn): by Douglas J. Futuyma, Sinauer Associates, 1986. $32.50 hbk (xii + 600 pages) ISBN 0 87893 188 0 (1987) (135)
Effects of body size, accessory gland and testis size on pre- and postcopulatory success in Drosophila melanogaster (2002) (134)
Loss of PLA2G6 leads to elevated mitochondrial lipid peroxidation and mitochondrial dysfunction (2015) (134)
Neurosteroids Enhance Spontaneous Glutamate Release in Hippocampal Neurons (2002) (134)
Lithium Promotes Longevity through GSK3/NRF2-Dependent Hormesis (2016) (133)
Response to Comment on "Long-Lived Drosophila with Overexpressed dFOXO in Adult Fat Body" (2005) (132)
RAPID LABORATORY EVOLUTION OF ADULT LIFE‐HISTORY TRAITS IN DROSOPHILA MELANOGASTER IN RESPONSE TO TEMPERATURE (1995) (130)
Neurosteroid-Induced Plasticity of Immature Synapses via Retrograde Modulation of Presynaptic NMDA Receptors (2005) (130)
Non-random mating and offspring fitness (1983) (126)
The endosymbiont Wolbachia increases insulin/IGF-like signalling in Drosophila (2009) (126)
A longer and healthier life with TOR down-regulation: genetics and drugs. (2011) (125)
RESISTANCE OF GENETIC CORRELATION STRUCTURE TO DIRECTIONAL SELECTION IN DROSOPHILA MELANOGASTER (1990) (125)
Adaptation and constraint in the evolution of Drosophila melanogaster wing shape (2000) (124)
Drosophila as a model for ageing. (2017) (122)
Body size and cell size in Drosophila: the developmental response to temperature. (1998) (120)
Interrelationships studied in a semibiological "reflex". (1972) (119)
DILP‐producing median neurosecretory cells in the Drosophila brain mediate the response of lifespan to nutrition (2010) (119)
Coordinated multitissue transcriptional and plasma metabonomic profiles following acute caloric restriction in mice. (2006) (117)
Matching Dietary Amino Acid Balance to the In Silico-Translated Exome Optimizes Growth and Reproduction without Cost to Lifespan (2017) (116)
Dietary Protein, Metabolism, and Aging. (2016) (115)
Tetraspanins in Viral Infections: a Fundamental Role in Viral Biology? (2005) (115)
Costing reproduction (2003) (113)
Benchmarks for ageing studies (2007) (113)
Mating-induced inhibition of remating in female Mediterranean fruit flies Ceratitis capitata. (1999) (113)
Gender and longevity: why do men die earlier than women? Comparative and experimental evidence. (2013) (112)
MODIFICATIONS OF NEURAL OUTPUT SIGNALS BY MUSCLES: A FREQUENCY RESPONSE STUDY. (1965) (112)
The Evolution of Behaviour (1982) (112)
Beyond the evolutionary theory of ageing, from functional genomics to evo-gero. (2006) (112)
Dietary restriction, mortality trajectories, risk and damage (2005) (111)
Life history response of Mediterranean fruit flies to dietary restriction (2002) (111)
Influence of temperature and activity on the metabolic rate of adult Drosophila melanogaster. (1997) (110)
Genome-wide dFOXO targets and topology of the transcriptomic response to stress and insulin signalling (2011) (110)
Nonclinality of molecular variation implicates selection in maintaining a morphological cline of Drosophila melanogaster. (2001) (110)
A Burkholderia pseudomallei Toxin Inhibits Helicase Activity of Translation Factor eIF4A (2011) (109)
Using the mitochondria-targeted ratiometric mass spectrometry probe MitoB to measure H2O2 in living Drosophila (2012) (108)
Temperature modulates epidermal cell size in Drosophila melanogaster. (2002) (108)
Localisation of the monocyte-binding region on human immunoglobulin G. (1986) (107)
The effect of reproductive activity on the longevity of male Drosophila melanogaster is not caused by an acceleration of ageing (1985) (106)
The effects of reproduction on longevity and fertility in male Drosophila melanogaster. (1997) (106)
The good enough calculi of evolving control systems: evolution is not engineering. (1982) (105)
Calcium-activated non-selective channels in the nervous system (1994) (104)
Dynamics of the action of dFOXO on adult mortality in Drosophila (2007) (102)
Diet, metabolism and lifespan in Drosophila (2005) (100)
Direct Keap1-Nrf2 disruption as a potential therapeutic target for Alzheimer’s disease (2017) (99)
Lifespan extension by dietary restriction in female Drosophila melanogaster is not caused by a reduction in vitellogenesis or ovarian activity (2004) (99)
No Influence of Indy on Lifespan in Drosophila after Correction for Genetic and Cytoplasmic Background Effects (2007) (99)
A Drosophila Model of Neuronopathic Gaucher Disease Demonstrates Lysosomal-Autophagic Defects and Altered mTOR Signalling and Is Functionally Rescued by Rapamycin (2016) (97)
Counting the calories: the role of specific nutrients in extension of life span by food restriction. (2005) (97)
Lack of Correlation between Mitochondrial Reactive Oxygen Species Production and Life Span in Drosophila (2004) (96)
Forkhead transcription factors and ageing (2008) (95)
Longevity GWAS Using the Drosophila Genetic Reference Panel (2015) (95)
No reduction in the cost of mating for Drosophila melanogaster females mating with spermless males (1993) (95)
Effect of a Standardised Dietary Restriction Protocol on Multiple Laboratory Strains of Drosophila melanogaster (2009) (95)
Developmentally Regulated Switch in Alternatively Spliced SNAP-25 Isoforms Alters Facilitation of Synaptic Transmission (2004) (94)
Evolutionary theories of ageing applied to long-lived organisms (2001) (94)
Hallmarks of aging: An expanding universe (2022) (94)
Lifespan extension by increased expression of the Drosophila homologue of the IGFBP7 tumour suppressor (2011) (94)
The Acp26Aa seminal fluid protein is a modulator of early egg hatchability in Drosophila melanogaster (2001) (92)
Changes of mitochondrial ultrastructure and function during ageing in mice and Drosophila (2017) (91)
Cellular basis of wing size variation in Drosophila melanogaster: a comparison of latitudinal clines on two continents (2000) (90)
Recombinant Extracellular Domains of Tetraspanin Proteins Are Potent Inhibitors of the Infection of Macrophages by Human Immunodeficiency Virus Type 1 (2006) (89)
Sex And Death In Protozoa (1988) (89)
STARVATION RESISTANCE AND ADULT BODY COMPOSITION IN A LATITUDINAL CLINE OF DROSOPHILA MELANOGASTER (2000) (89)
Short-Term, Intermittent Fasting Induces Long-Lasting Gut Health and TOR-Independent Lifespan Extension (2018) (89)
Life History Constraints on Sexual Selection (1987) (88)
The contrasting genetic architecture of wing size and shape in Drosophila melanogaster (2001) (88)
Gene–environment interaction for body size and larval density in Drosophila melanogaster: an investigation of effects on development time, thorax length and adult sex ratio (1994) (86)
Temperature and clinal variation in larval growth efficiency in Drosophila melanogaster (2001) (84)
Regulation of Lifespan, Metabolism, and Stress Responses by the Drosophila SH2B Protein, Lnk (2010) (84)
Normal Development of Embryonic Thalamocortical Connectivity in the Absence of Evoked Synaptic Activity (2002) (84)
Toward antibody-directed "abzyme" prodrug therapy, ADAPT: carbamate prodrug activation by a catalytic antibody and its in vitro application to human tumor cell killing. (1996) (84)
Is accelerated senescence a cost of reproduction (1987) (84)
EVOLUTIONARY EFFECTS OF SELECTION ON AGE AT REPRODUCTION IN LARVAL AND ADULT: DROSOPHILA MELANOGASTER (1993) (83)
Block of hippocampal CAN channels by flufenamate (2000) (83)
Replication of Extended Lifespan Phenotype in Mice with Deletion of Insulin Receptor Substrate 1 (2011) (83)
MTERF3 Regulates Mitochondrial Ribosome Biogenesis in Invertebrates and Mammals (2013) (82)
Flight activity, mortality rates, and lipoxidative damage in Drosophila. (2006) (82)
Thermal evolution of pre‐adult life history traits in Drosophila melanogaster (1994) (82)
Interpreting interactions between treatments that slow aging (2002) (81)
Patterns of Diversity and Linkage Disequilibrium Within the Cosmopolitan Inversion In(3R)Payne in Drosophila melanogaster Are Indicative of Coadaptation (2006) (81)
Overwintering in Drosophila melanogaster: outdoor field cage experiments on clinal and laboratory selected populations help to elucidate traits under selection (2003) (80)
Ageing: Levelling of the grim reaper (1997) (80)
Probability of peripheral interaction between motor units and implications for motor control. (1980) (78)
Tetraspanins: gateways for infection. (2012) (78)
Lowered Insulin Signalling Ameliorates Age-Related Sleep Fragmentation in Drosophila (2014) (78)
QTL MAPPING REVEALS A STRIKING COINCIDENCE IN THE POSITIONS OF GENOMIC REGIONS ASSOCIATED WITH ADAPTIVE VARIATION IN BODY SIZE IN PARALLEL CLINES OF DROSOPHILA MELANOGASTER ON DIFFERENT CONTINENTS (2003) (77)
Neural Control Drives a Muscle Spring: A Persisting yet Limited Motor Theory (1983) (76)
Sex peptide of Drosophila melanogaster males is a global regulator of reproductive processes in females (2012) (76)
Measuring reproductive costs. (1992) (76)
Mating and hormonal triggers regulate accessory gland gene expression in male Drosophila. (1997) (75)
Turnover-based in vitro selection and evolution of biocatalysts from a fully synthetic antibody library (2003) (75)
C9orf72 arginine-rich dipeptide proteins interact with ribosomal proteins in vivo to induce a toxic translational arrest that is rescued by eIF1A (2019) (74)
Biomarkers of aging in Drosophila (2010) (74)
Individual differences in feeding efficiencies and feeding preferences of captive great tits (1976) (74)
Quantitative genetic analysis of natural variation in body size in Drosophila melanogaster (2002) (73)
Sexual conflict as fuel for evolution (1996) (72)
Two forms of death in ageing Caenorhabditis elegans (2017) (72)
Intrinsic feedback factors producing inertial compensation in muscle. (1967) (70)
RPS25 is required for efficient RAN translation of C9orf72 and other neurodegenerative disease-associated nucleotide repeats (2019) (69)
AN INTERACTION BETWEEN ENVIRONMENTAL TEMPERATURE AND GENETIC VARIATION FOR BODY SIZE FOR THE FITNESS OF ADULT FEMALE DROSOPHILA MELANOGASTER (1997) (69)
Habitat selection in titmice (1974) (69)
Lithium suppresses Aβ pathology by inhibiting translation in an adult Drosophila model of Alzheimer's disease (2014) (69)
Correlated responses to selection on body size in Drosophila melanogaster. (1999) (69)
Invertebrate models of age-related muscle degeneration. (2009) (69)
Increased Glucose Transport into Neurons Rescues Aβ Toxicity in Drosophila (2016) (68)
No extension of lifespan by ablation of germ line in Drosophila (2006) (68)
The rare-male effect: what is its evolutionary significance? (1988) (68)
Assessing the Mitochondrial Membrane Potential in Cells and In Vivo using Targeted Click Chemistry and Mass Spectrometry (2016) (67)
DIFFERENT CELL SIZE AND CELL NUMBER CONTRIBUTION IN TWO NEWLY ESTABLISHED AND ONE ANCIENT BODY SIZE CLINE OF DROSOPHILA SUBOBSCURA (2003) (67)
Testing for asymmetrical gene flow in a Drosophila melanogaster body-size cline. (2003) (67)
Remating and male‐derived nutrients in Drosophila melanogaster (1994) (66)
The Bicoid Stability Factor Controls Polyadenylation and Expression of Specific Mitochondrial mRNAs in Drosophila melanogaster (2011) (66)
Heritability of pre–adult viability differences can explain apparent heritability of sperm displacement ability in Drosophila melanogaster (1997) (66)
Estimation of the Thermal Niche of Drosophila melanogaster Using a Temperature-Sensitive Mutation (1987) (65)
Lifetime reproductive success in Drosophila (1988) (65)
A courtship advantage for small males in Drosophila subobscura (1988) (64)
Convergence of visceral and somatic input onto spinal neurons. (1970) (64)
Structural requirements for the inhibitory action of the CD9 large extracellular domain in sperm/oocyte binding and fusion. (2003) (63)
Some highlights of research on aging with invertebrates, 2010 (2007) (63)
Some limitations on the removal of periodic noise by averaging. (1972) (63)
mTORC1 and mTORC2 regulate skin morphogenesis and epidermal barrier formation (2016) (62)
Science fact and the SENS agenda (2005) (61)
A nutritional memory effect counteracts benefits of dietary restriction in old mice (2019) (60)
Somatic and visceral receptive field properties of fibers in ventral quadrant white matter of the cat spinal cord. (1970) (60)
The evolution of longevity (2002) (60)
Acetylation mimic of lysine 280 exacerbates human Tau neurotoxicity in vivo (2016) (59)
Field and laboratory observations on the foraging and feeding techniques of blue tits (Parus caeruleus) and coal tits (P. ater) in relation to their habitats (1976) (57)
Natural Selection: Evolving evolvability (2000) (57)
Distinct roles for tetraspanins CD9, CD63 and CD81 in the formation of multinucleated giant cells (2009) (56)
The Role of the N-terminal Domain of the Complement Fragment Receptor C5L2 in Ligand Binding* (2006) (56)
An Insulin-Sensitive Circular RNA that Regulates Lifespan in Drosophila (2020) (56)
Insulin signalling regulates remating in female Drosophila (2010) (56)
Intervening in ageing to prevent the diseases of ageing (2014) (54)
Interplay of dFOXO and Two ETS-Family Transcription Factors Determines Lifespan in Drosophila melanogaster (2014) (54)
A triple drug combination targeting components of the nutrient-sensing network maximizes longevity (2019) (53)
Death and dessert: nutrient signalling pathways and ageing. (2011) (53)
An effect of egg-deposition on the subsequent fertility and remating frequency of female Drosophila melanogaster (1988) (53)
Food pulses increase longevity and induce cyclical egg production in Mediterranean fruit flies (2002) (53)
Thermal evolution of growth efficiency in Drosophila melanogaster (1995) (52)
Calcium Channels: Their Properties, Functions, Regulation, and Clinical Relevance (1991) (52)
Quantitative Assessment of Eye Phenotypes for Functional Genetic Studies Using Drosophila melanogaster (2016) (51)
Cell-Nonautonomous Effects of dFOXO/DAF-16 in Aging (2014) (51)
Tackling immunosenescence to improve COVID-19 outcomes and vaccine response in older adults (2020) (51)
Ageing as a risk factor for ALS/FTD (2017) (51)
Sense and antisense RNA are not toxic in Drosophila models of C9orf72-associated ALS/FTD (2018) (50)
Gene expression‐based drug repurposing to target aging (2018) (50)
Lords of the Fly (1995) (48)
Comment on "Brain IRS2 Signaling Coordinates Life Span and Nutrient Homeostasis" (2008) (48)
The place of genetics in ageing research (2012) (47)
Dibutyryl cyclic AMP stimulation of a monocyte-like cell line, U937: a model for monocyte chemotaxis and Fc receptor-related functions. (1988) (47)
RAPID LABORATORY EVOLUTION OF ADULT WING AREA IN DROSOPHILA MELANOGASTER IN RESPONSE TO HUMIDITY (2003) (47)
Neurosteroid-induced enhancement of glutamate transmission in rat hippocampal slices (2001) (47)
Insulin and TOR signal in parallel through FOXO and S6K to promote epithelial wound healing (2016) (46)
Complementation between polymerase- and exonuclease-deficient mitochondrial DNA polymerase mutants in genomically engineered flies (2015) (46)
How was movement controlled before Newton? (1982) (46)
Fasting, but Not Aging, Dramatically Alters the Redox Status of Cysteine Residues on Proteins in Drosophila melanogaster (2015) (46)
Transfer of molecules from ejaculate to females in Drosophila melanogaster and Drosophila pseudoobscura (1987) (46)
Genetic models of C9orf72: what is toxic? (2017) (45)
Mapping Regions Within Cosmopolitan Inversion In(3R)Payne Associated With Natural Variation in Body Size in Drosophila melanogaster (2007) (45)
Dietary restriction delays aging, but not neuronal dysfunction, in Drosophila models of Alzheimer's disease (2011) (44)
Toward a control theory analysis of aging. (2008) (44)
Regulation of Zebrafish Hatching by Tetraspanin cd63 (2011) (44)
Bidirectional nucleolar dysfunction in C9orf72 frontotemporal lobar degeneration (2017) (44)
Reduced molecular expression of K(+) channel proteins in vascular smooth muscle from rats made hypertensive with N{omega}-nitro-L-arginine. (2005) (44)
Computational analysis of alpha-helical membrane protein structure: implications for the prediction of 3D structural models. (2004) (44)
Pitfalls of measuring feeding rate in the fruit fly Drosophila melanogaster (2008) (43)
Ca2+ store‐dependent potentiation of Ca2+‐activated non‐selective cation channels in rat hippocampal neurones in vitro (1999) (43)
Protocols to Study Aging in Drosophila (2016) (43)
Characterisation of receptor binding by the chemotaxis inhibitory protein of Staphylococcus aureus and the effects of the host immune response (2007) (43)
On the use of tester stocks to predict the competitive ability of genotypes (1992) (42)
Geographic Variation in Competitive Ability in Drosophila melanogaster (1998) (42)
Cooperative Role for Tetraspanins in Adhesin-Mediated Attachment of Bacterial Species to Human Epithelial Cells (2011) (42)
Laboratory Adaptation of Life History in Drosophila (2001) (42)
Nuclear hormone receptor DHR96 mediates the resistance to xenobiotics but not the increased lifespan of insulin-mutant Drosophila (2016) (41)
Intracellular calcium signaling induced by thapsigargin in excitable and inexcitable cells. (1994) (40)
Sex-specific selection on time to remate inDrosophila melanogaster (1998) (40)
Characterization of a complement-fragment-C5a-stimulated calcium-influx mechanism in U937 monocytic cells. (1993) (40)
Increased preferences for familiar foods in small mammals (1981) (39)
Sexual Activity and Life Span (1986) (39)
Ageing Increases Vulnerability to Aβ42 Toxicity in Drosophila (2012) (39)
Some highlights of research on aging with invertebrates, 2006–2007 (2007) (39)
Pregnenolone sulfate acts through a G-protein-coupled sigma1-like receptor to enhance short term facilitation in adult hippocampal neurons. (2005) (39)
Is bacterial evolution random or selective? (1988) (39)
Analysis of multiunit spike records. (1971) (38)
Myostatin-like proteins regulate synaptic function and neuronal morphology (2017) (38)
Molecular recognition of antibody (IgG) by cellular Fc receptor (FcRI). (1988) (38)
Dietary Restriction , Growth Factors and Aging : from yeast to humans (2013) (38)
Vascular endothelial insulin/IGF-1 signaling controls skin wound vascularization. (2012) (38)
Current developments at Philosophical Transactions of the Royal Society B (2012) (38)
Male identity and sperm displacement in Drosophila melanogaster (1995) (38)
Strategies for Targeting Tetraspanin Proteins (2012) (38)
Detrimental Effects of RNAi: A Cautionary Note on Its Use in Drosophila Ageing Studies (2012) (38)
Cloning and characterisation of TPO autoantibodies using combinatorial phage display libraries. (1994) (37)
Branched-Chain Amino Acids Have Equivalent Effects to Other Essential Amino Acids on Lifespan and Aging-Related Traits in Drosophila (2019) (37)
Genetic Variation for Total Fitness in Drosophila melanogaster (2005) (37)
Receptive fields of rat retinal ganglion cells. (1970) (37)
Variation in male fertility explains an apparent effect of genotypic diversity on success in larval competition in Drosophila melanogaster (1986) (37)
Intestinal Fork Head Regulates Nutrient Absorption and Promotes Longevity (2017) (37)
The role of tetraspanins in fusion. (2011) (37)
The effect of dietary restriction on mitochondrial protein density and flight muscle mitochondrial morphology in Drosophila. (2006) (37)
Dietary Restriction Extends Lifespan in Wild-Derived Populations of Drosophila melanogaster (2013) (37)
Modulation of calcium‐activated non‐specific cation currents by cyclic AMP‐dependent phosphorylation in neurones of Helix. (1990) (37)
A proteomic atlas of insulin signalling reveals tissue‐specific mechanisms of longevity assurance (2017) (37)
Modulation of glutamatergic transmission by sulfated steroids: Role in fetal alcohol spectrum disorder (2008) (36)
Nuclear hormone receptors: Roles of xenobiotic detoxification and sterol homeostasis in healthy aging (2015) (36)
Comparison of human monocytes isolated by elutriation and adherence suggests that heterogeneity may reflect a continuum of maturation/activation states. (1988) (36)
Mutation of Glutamate 199 of the Human C5a Receptor Defines a Binding Site for Ligand Distinct from the Receptor N Terminus (*) (1995) (36)
Ageing: A lethal side-effect (2002) (35)
Male mating success and fertility in Drosophila melanogaster (1985) (35)
Aβ43 is neurotoxic and primes aggregation of Aβ40 in vivo (2015) (35)
Good Ol' Fat: Links between Lipid Signaling and Longevity. (2017) (34)
The genetic bases of divergence in desiccation and starvation resistance among tropical and temperate populations of Drosophila melanogaster (2001) (34)
Superoxide dismutase activities in long-lived Drosophila melanogaster females: chico1 genotypes and dietary dilution (2007) (34)
Evolution of aging: Testing the theory usingDrosophila (1993) (34)
Molecular basis of adaptive shift in body size in Drosophila melanogaster: functional and sequence analyses of the Dca gene. (2011) (33)
The use of anti-IgG monoclonal antibodies in mapping the monocyte receptor site on IgG. (1986) (33)
Observations on types of response to combinations of neck, vestibular, and muscle stretch signals. (1969) (33)
Current-voltage relationships of repetitively firing neurons (1979) (33)
Action of diphenylamine carboxylate derivatives, a family of non-steroidal anti-inflammatory drugs, on [Ca2+]i and Ca2+-activated channels in neurons (1995) (33)
Joint regulation of cell size and cell number in the wing blade of Drosophila melanogaster. (1997) (32)
The new science of ageing (2011) (32)
Genetic variation for total fitness in Drosophila melanogaster (1997) (32)
Brief carbon dioxide exposure blocks heat hardening but not cold acclimation in Drosophila melanogaster. (2008) (32)
Modulation of GABAergic and glutamatergic transmission by ethanol in the developing neocortex: An in vitro test of the excessive inhibition hypothesis of fetal alcohol spectrum disorder (2009) (32)
Adaptation in regulation of movement and posture. A study of stretch responses in spastic animals. (1960) (31)
Special issue on dietary restriction: Dietary restriction, longevity and ageing—the current state of our knowledge and ignorance (2005) (31)
Science fact and the SENS agenda. What can we reasonably expect from ageing research? (2005) (31)
Regulation of gene expression is preserved in aging Drosophila melanogaster (1998) (31)
Dietary Restriction and Life-Span (2002) (30)
Activation and modulation of calcium-activated non-selective cation channels from embryonic chick sensory neurons (1993) (30)
SELECTION ON AGE AT REPRODUCTION IN DROSOPHILA MELANOGASTER: FEMALE MATING FREQUENCY AS A CORRELATED RESPONSE (2000) (30)
Lack of response to sex-peptide results in increased cost of mating in dunce Drosophila melanogaster females (1996) (30)
Genome-Wide Transcription Analysis of Clinal Genetic Variation in Drosophila (2012) (30)
Using the drug-protein interactome to identify anti-ageing compounds for humans (2018) (30)
Mechanisms for frequency-dependent mating success (1984) (29)
Growing old gracefully (1991) (29)
Drug repurposing for aging research using model organisms (2017) (29)
Drosophila melanogaster LRPPRC2 is involved in coordination of mitochondrial translation (2014) (29)
Single Ca-activated cation channels in bursting neurons ofHelix (1987) (29)
Alterations in mossy fiber physiology and GAP‐43 expression and function in transgenic mice overexpressing HuD (2008) (28)
Mixed-Species Flocks of Birds in Hill Forest in Ceylon (1976) (28)
Unravelling animal behaviour (1986) (28)
Deletion of endogenous Tau proteins is not detrimental in Drosophila (2016) (28)
pGluAβ increases accumulation of Aβ in vivo and exacerbates its toxicity (2016) (27)
Mutations of mitochondrial DNA are not major contributors to aging of fruit flies (2018) (27)
Correcting for sequence biases in present/absent calls (2007) (27)
A mechanism for minimizing temperature effects on repetitive firing frequency. (1978) (27)
Translational strategies in aging and age-related disease (2015) (27)
Mechanism of action of the non-steroidal anti-inflammatory drug flufenamate on [Ca2+]i and Ca(2+)-activated currents in neurons. (1996) (26)
Vascular smooth muscle cell membrane depolarization after NOS inhibition hypertension. (2002) (26)
Corneal Infection Models: Tools to Investigate the Role of Biofilms in Bacterial Keratitis (2020) (25)
Olfactory preferences of inbred mice (Mus musculus) for their own strain and for siblings: effects of strain, sex and cross-fostering. (1981) (25)
The effects of lithium and sodium on the potassium conductance of snail neurones. (1976) (25)
These hierarchical views of life: phylogenies and metapopulations (1991) (24)
Pseudo-acetylation of multiple sites on human Tau proteins alters Tau phosphorylation and microtubule binding, and ameliorates amyloid beta toxicity (2017) (24)
Peptides from Tetraspanin CD9 Are Potent Inhibitors of Staphylococcus Aureus Adherence to Keratinocytes (2016) (24)
The Insulin Signaling Pathway and Aging in Drosophila (2001) (24)
Coupling of AMPA receptors with the Na+/Ca2+ exchanger in cultured rat astrocytes (2000) (24)
Sestrin is a key regulator of stem cell function and lifespan in response to dietary amino acids (2020) (24)
Fine-tuning autophagy maximises lifespan and is associated with changes in mitochondrial gene expression in Drosophila (2020) (24)
Influence of female reproductive anatomy on the outcome of sperm competition in Drosophila melanogaster (2003) (23)
ACE2-Independent Interaction of SARS-CoV-2 Spike Protein with Human Epithelial Cells Is Inhibited by Unfractionated Heparin (2021) (23)
Polymorphism in the neurofibromin gene, Nf1, is associated with antagonistic selection on wing size and development time in Drosophila melanogaster (2013) (23)
Murderous mandibles and black holes in hymenopteran wasps (1987) (23)
Expression of human uncoupling protein-3 in Drosophila insulin-producing cells increases insulin-like peptide (DILP) levels and shortens lifespan (2009) (23)
Regulation of the one carbon folate cycle as a shared metabolic signature of longevity (2020) (23)
Reduced insulin/insulin-like growth factor signaling decreases translation in Drosophila and mice (2016) (23)
Functional conservation in genes and pathways linking ageing and immunity (2021) (23)
A combinatorial phage display library for the generation of specific Fab fragments recognizing human spermatozoa and inhibiting fertilizing capacity in vitro. (1998) (23)
A double whammy for aging? Rapamycin extends lifespan and inhibits cancer in inbred female mice (2012) (23)
The Functions of Insulin-like Peptides in Insects (2010) (23)
A transient cerebellar influence on stretch responses. (1962) (23)
Female sensitivity to diet and irradiation treatments underlies sex-mortality differentials in the Mediterranean fruit fly. (2001) (22)
Longevity in response to lowered insulin signaling requires glycine N‐methyltransferase‐dependent spermidine production (2019) (22)
The identification of endothelial cell autoantigens. (2000) (22)
Some highlights of research on aging with invertebrates, 2008 (2008) (22)
Loss of PLA 2 G 6 leads to elevated mitochondrial lipid peroxidation and mitochondrial dysfunction (2015) (22)
Tspan2: a tetraspanin protein involved in oligodendrogenesis and cancer metastasis (2017) (21)
Common genetic associations between age-related diseases (2020) (21)
Antibodies against human CD63 activate transfected rat basophilic leukemia (RBL-2H3) cells. (1995) (21)
Evolutionary biology: Group selection and the sex ratio (1985) (21)
Direct screening for phosphatase activity by turnover-based capture of protein catalysts. (2002) (21)
Unfractionated heparin potently inhibits the binding of SARS-CoV-2 spike protein to a human cell line (2020) (21)
Direct Screening for Phosphatase Activity by Turnover-Based Capture of Protein Catalysts This work was supported by BBSRC studentships (to J.B. and H.D.), by an EPSRC studentship (to J.H.R.), and by an EC TMR studentship (to S.C.-T.). (2002) (20)
Constraints on the effects of sexual selection (1987) (20)
A genetic correlation between the sexes for mating speed in Drosophila melanogaster (1992) (20)
Failure to Replicate the Results of an Experiment on the Rare Male Effect in Drosophila menlanogaster (1983) (20)
Electrophysiological Recordings from the Giant Fiber Pathway of D. melanogaster (2011) (20)
The Use of Plant-Derived Ribosome Inactivating Proteins in Immunotoxin Development: Past, Present and Future Generations (2017) (20)
Gene-environment interactions affect long-term depression (LTD) through changes in dopamine receptor affinity in Snap25 deficient mice (2013) (20)
Population genetics: Tissue rejection: the price of sexual acceptance? (1983) (19)
Long-term in vivo imaging of Drosophila larvae (2019) (19)
Evolutionary biology and age-related mortality (1997) (19)
Reduced insulin signaling maintains electrical transmission in a neural circuit in aging flies (2017) (19)
Diet and healthy aging. (2012) (19)
Myeloid Cell–Restricted Insulin/IGF-1 Receptor Deficiency Protects against Skin Inflammation (2015) (19)
A TORC1-histone axis regulates chromatin organisation and non-canonical induction of autophagy to ameliorate ageing (2021) (19)
Chromatin remodeling due to degradation of citrate carrier impairs osteogenesis of aged mesenchymal stem cells (2021) (19)
11 Yeast, a Feast: The Fruit Fly Drosophila as a Model Organism for Research into Aging (2008) (19)
An advantage for specialist feeding in jackdaws, Corvus monedula (1987) (18)
The role of calcium in pentylenetetrazol-induced bursting (1982) (18)
Experimental analysis of risk factors for ulcerative dermatitis in mice (2012) (18)
Genetic and non-genetic approaches to questions about sexual selection (1994) (18)
Evolution: Contentious issues in sexual selection (1986) (18)
Dynamic characteristics of response in a vestibulomotor reflex. (1969) (18)
Neurosteroid paradoxical enhancement of paired-pulse inhibition through paired-pulse facilitation of inhibitory circuits in dentate granule cells (2005) (18)
Increased Glucose Transport into Neurons Rescues Aβ Toxicity in Drosophila (2016) (17)
Methuselah among nematodes (1993) (17)
A possible source of nerve signal distortion arising in pulse rate encoding of signals. (1966) (17)
Antibody cross‐linking of human CD9 and the high‐affinity immunoglobulin E receptor stimulates secretion from transfected rat basophilic leukaemia cells (2000) (17)
A neuronal blood marker is associated with mortality in old age (2021) (17)
Pentylenetetrazol-induced bursting activity in the absence of a negative conductance characteristics (1975) (17)
Animal Behavior: Psychobiology, Ethology and Evolution, David McFarland. Benjamin/Cummings, Menlo Park, California (1985), xiv, +576, Price $28.95 (1986) (17)
Neurosteroid‐induced enhancement of short‐term facilitation involves a component downstream from presynaptic calcium in hippocampal slices (2006) (17)
Monocyte Subsets Have Distinct Patterns of Tetraspanin Expression and Different Capacities to Form Multinucleate Giant Cells (2018) (17)
Some highlights of research on aging with invertebrates, 2009 (2009) (16)
Integration in the Central Nervous System (1973) (16)
Immunogenic and antigenic epitopes of immunoglobulins. II. Antigenic differences between secreted and membrane IgG demonstrated using monoclonal antibodies. (1982) (16)
A mortality cost of virginity at older ages in female Mediterranean fruit flies (2002) (16)
Estimation and correction of non-specific binding in a large-scale spike-in experiment (2007) (16)
Group selection and the sex ratio. (1985) (16)
Longevity of Indy mutant Drosophila not attributable to Indy mutation (2009) (16)
Distinct Regions of the Large Extracellular Domain of Tetraspanin CD9 Are Involved in the Control of Human Multinucleated Giant Cell Formation (2014) (16)
Erratum: Matching Dietary Amino Acid Balance to the In Silico-Translated Exome Optimizes Growth and Reproduction without Cost to Lifespan (Cell Metabolism (2015) 25(3) (610–621) (S1550413117300955) (10.1016/j.cmet.2017.02.005)) (2017) (16)
A cost of receiving sperm in the female fruitfly Drosophila melanogaster (1991) (15)
Using Answer Set Programming to Integrate RNA Expression with Signalling Pathway Information to Infer How Mutations Affect Ageing (2012) (15)
Presynaptic residual calcium and synaptic facilitation at hippocampal synapses of mice with altered expression of SNAP-25 (2012) (15)
Dissociated dopaminergic neurons from substantia nigra zona compacta in young rats lack functional NMDA receptors (1998) (15)
Contributions of SERCA pump and ryanodine-sensitive stores to presynaptic residual Ca2+. (2010) (15)
Promoting Health and Longevity through Diet : FromModel Organisms to Humans (2015) (15)
Loss of miR-210 leads to progressive retinal degeneration in Drosophila melanogaster (2019) (14)
Water-independent effects of dietary restriction in Drosophila (2010) (14)
Differences in behaviour between blue and coal tits reared under identical conditions (1979) (14)
The isolation and characterisation of antiplatelet antibodies (2006) (14)
Genetics of Aging in Drosophila (2001) (14)
Multiple signalling pathways in the C5a-induced expression of adhesion receptor Mac-1. (1994) (14)
Two complementary approaches for intracellular delivery of exogenous enzymes (2015) (14)
Effect of intracellular lithium on snail neurones (1974) (14)
ISOGENIC AUTOSOMES TO BE APPLIED IN OPTIMAL SCREENING FOR NOVEL MUTANTS WITH VIABLE PHENOTYPES IN DROSOPHILA MELANOGASTER (2005) (14)
Glycine-alanine dipeptide repeats spread rapidly in a repeat length- and age-dependent manner in the fly brain (2019) (13)
High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity. (2003) (13)
Comment by Matthew Piper, William Mair, Linda Partridge on Min, K.J., Flatt, T., Kulaots, I., Tatar, M. (2006) “Counting calories in Drosophila dietary restriction” Exp. Gerontology, doi:10.1016/j.exger.2006.10.009 (2007) (13)
Of cuckoo clocks and cowbirds (1988) (13)
THORAX LENGTH IN DROSOPHILA MELANOGASTER (1993) (13)
Models of insulin signalling and longevity (2005) (13)
Identifying Potential Ageing-Modulating Drugs In Silico (2019) (13)
Long-lasting geroprotection from brief rapamycin treatment in early adulthood by persistently increased intestinal autophagy (2022) (13)
SurvCurv database and online survival analysis platform update (2015) (13)
Tissue rejection: the price of sexual acceptance? (1983) (13)
Chemical Complexity and the Genetics of Aging. (2007) (13)
A functioning ovary is not required for sex peptide to reduce receptivity to mating in D. melanogaster. (2007) (13)
Matching Dietary Amino Acid Balance to the In Silico-Translated Exome Optimizes Growth and Reproduction without Cost to Lifespan (2017) (12)
Muscle, the Motor (2011) (12)
Bird coloration and parasites — a task for the future? (1982) (12)
Cytoplasmic Ca2+ activity regulation as measured by a calcium-activated current (1994) (12)
The Nervous System: Its Function and Its Interaction with the World (1992) (12)
A mitochondrial membrane-bridging machinery mediates signal transduction of intramitochondrial oxidation (2021) (12)
The Nervous System: Its Function and Its Interaction with the World (1992) (12)
The neuronal receptor tyrosine kinase Alk is a target for longevity (2020) (12)
ACE2-independent interaction of SARS-CoV-2 spike protein to human epithelial cells can be inhibited by unfractionated heparin (2020) (11)
Data-driven identification of ageing-related diseases from electronic health records (2021) (11)
Modulation by pregnenolone sulfate of filtering properties in the hippocampal trisynaptic circuit (2012) (11)
Impact of insulin signaling and proteasomal activity on physiological output of a neuronal circuit in aging Drosophila melanogaster (2018) (11)
Characterization of Ocular Clinical Isolates of Pseudomonas aeruginosa from Non-Contact Lens Related Keratitis Patients from South India (2020) (11)
Interspecies contamination of the KM3 cell line: Implications for CD63 function in melanoma metastasis (2003) (11)
Neurosteroid modulation of glutamate release in hippocampal neurons: lack of an effect of a chronic prenatal ethanol exposure paradigm. (2003) (11)
Constraints on the effects of sexual selection. Group report. (1987) (11)
Resting potential and muscle fiber size in hereditary mouse muscle dystrophy. (1961) (11)
Developmental changes in presynaptic Ca2+ clearance kinetics and synaptic plasticity in mouse Schaffer collateral terminals (2010) (10)
Bio-potential Neural Activation of Artificial Muscles (2007) (10)
Neurosteroids enhance bandpass filter characteristics of the rat Schaffer collateral-to-CA1 synapse (2002) (10)
Stage debut for the elusive Drosophila insulin-like growth factor binding protein (2008) (10)
The site of action for the convulsant effect of pentylenetetrazol. (1981) (10)
The effect of pentylenetetrazol on inward currents of non-bursting neurons and its role in plateau formation (1984) (10)
Biological mechanisms of aging predict age‐related disease co‐occurrence in patients (2022) (10)
FoxO1 Is a Novel Regulator of 20S Proteasome Subunits Expression and Activity (2021) (9)
Pervasive effects of P element mutagenesis on body size in Drosophila melanogaster. (1998) (9)
A lethal side-effect. (2002) (9)
Chemical changes in aging Drosophila melanogaster (2009) (9)
Genetic correlation between the sexes in Drosophila melanogaster: a reply to Butlin (1993) (9)
Living longer by dieting: analysis of transcriptional response after caloric restriction (2005) (9)
Fasting, but Not Aging, Dramatically Alters the Redox Status of Cysteine Residues on Proteins in Drosophila melanogaster (2015) (9)
The sequential-interval state space: a means of displaying temporal information in neuron firing (1989) (8)
Hydroxylamine blocks adenosine A1 receptor-mediated inhibition of synaptic transmission in rat hippocampus (1999) (8)
Celebrating 350 years of Philosophical Transactions: life sciences papers (2015) (8)
Sexual activity reduces longevity of male fruitflies. (1981) (8)
Effects of nutrition and peripheral stimuli on preferences for familiar foods in the bank vole (1981) (8)
A crash course in survival (1994) (8)
Calcium independence of slow currents underlying spike frequency adaptation. (1980) (8)
Subclasses of IgG on the surface of human lymphocytes: a study with monoclonal antibodies. (1984) (8)
Of Worms, Mice & Men: Altering Rates of Aging (2006) (8)
Evolution, senescence, and health in old age (1999) (8)
Complex roles of myoglianin in regulating adult performance and lifespan (2017) (8)
Three-generation family conflict (1977) (8)
Enhanced insulin signalling ameliorates C9orf72 hexanucleotide repeat expansion toxicity in Drosophila (2021) (8)
CANARY ISLAND BLUE TITS AND ENGLISH COAL TITS: CONVERGENT EVOLUTION? (1977) (8)
By the Book: Audubon and the Tradition of Ornithological Illustration (1996) (8)
Latitudinal variation of body and wing shape in Drosophila melanogaster (1998) (8)
Hepatic gene body hypermethylation is a shared epigenetic signature of murine longevity (2018) (8)
Some aspects of the morphology of Blue tits (Parus caemleus) and Coal tits (Parus ater) in relation to their behaviour (2009) (8)
Convergence of Information (2003) (8)
Convergence of Information (2003) (8)
A role for the tetraspanin proteins in Salmonella infection of human macrophages. (2017) (7)
Cocaine inhibits 5-HT3 receptor function in neurons from transgenic mice overexpressing the receptor. (2003) (7)
Menopause for thought (1993) (7)
Tissue-specific modulation of gene expression in response to lowered insulin signalling in Drosophila (2021) (7)
Antagonizing Methuselah to extend life span (2007) (7)
Using Doubly-Labeled Water to Measure Energy Expenditure in an Important Small Ectotherm Drosophila melanogaster (2014) (6)
A role for tetraspanin proteins in regulating fusion induced by Burkholderia thailandensis (2020) (6)
Isoprenaline-induced and constitutive members of a proline-rich protein sub-group from mouse parotid glands studied with monoclonal antibody NAL1. (1989) (6)
Establishing a Porcine Ex Vivo Cornea Model for Studying Drug Treatments against Bacterial Keratitis. (2020) (6)
Cell-mediated immunity in calves experimentally infected with BHV-1 (1990) (6)
Understanding the tipping point of urban conflict (2010) (6)
Calcium buffering in bursting Helix pacemaker neurons (1993) (6)
Hydroxylamine blocks pre- but not postsynaptic adenosine A1 receptor-mediated actions in rat hippocampus (1999) (6)
A twelve-way rotary tap for changing physiological solutions. (1975) (6)
Measuring fitness by means of balancer chromosomes. (2000) (6)
Does mate choice occur in Drosophila melanogaster? (reply) (1981) (6)
Sexual activity and lifespan (1986) (6)
Transcriptomic profiling of long- and short-lived mutant mice implicates mitochondrial metabolism in ageing and shows signatures of normal ageing in progeroid mice (2020) (6)
GENETIC VARIATION FOR PREADULT VIABILITY IN DROSOPHILA MELANOGASTER (2001) (6)
An interaction between the effects of temperature and body size on the fitness of female Drosophila melanogaster. (1997) (6)
What the sperm count costs (1992) (6)
Haldane's rule and the hazards of heterogamety (1993) (6)
PICALM rescues glutamatergic neurotransmission, behavioural function and survival in a Drosophila model of Aβ42 toxicity (2020) (5)
Sexual identity of enterocytes regulates rapamycin-mediated intestinal homeostasis and lifespan extension (2021) (5)
Dietary restriction in Drosophila. Response (2004) (5)
Erratum to “Dietary restriction delays aging, but not neuronal dysfunction, in Drosophila models of Alzheimer's disease.” [Neurobiol. Aging 32 (2011) 1977–1989] (2015) (5)
The evolution of non-infectious and degenerative disease (1999) (5)
Dynamic changes in the brain protein interaction network correlates with progression of Aβ42 pathology in Drosophila (2018) (5)
A Computational Model of the Escape Response Latency in the Giant Fiber System of Drosophila melanogaster (2018) (5)
Tetraspanins are involved in Burkholderia pseudomallei-induced cell-to-cell fusion of phagocytic and non-phagocytic cells (2020) (5)
Crystallization of a carbamatase catalytic antibody Fab fragment and its complex with a transition-state analogue. (2004) (5)
Independent glial subtypes delay development and extend healthy lifespan upon reduced insulin-PI3K signalling (2020) (5)
Meeting Report: Aging Research and Drug Discovery (2022) (4)
Generation of the Membrane Potential (2003) (4)
Aging-associated changes in transcriptional elongation influence metazoan longevity (2019) (4)
Frogs solve Bernstein's problem (1986) (4)
Individual feeding specialisations and population dynamics (1985) (4)
Could cancer drugs provide ammunition against aging? (2016) (4)
The medical potential of catalytic antibodies (1996) (4)
Gerontology. Methuselah among nematodes. (1993) (4)
Production of catalytic antibodies using combinatorial libraries. (1993) (4)
Does the CDR3 of the heavy chain determine the specificity of autoantibodies in systemic lupus erythematosus? (1998) (4)
STRETCH REFLEX INTERACTIONS STUDIED WITH THE AID OF SIMULATION (1965) (4)
Cell type-specific modulation of healthspan by Forkhead family transcription factors in the nervous system (2021) (4)
The effect of pentylenetetrazol on spike broadening and potassium inactivation. (1984) (4)
2nd interventions in aging conference (2017) (4)
Gerontology: Mutation, variation and the evolution of ageing (1994) (4)
Transposable Element Landscape in Drosophila Populations Selected for Longevity (2019) (4)
Gerontology: Extending the healthspan (2016) (4)
Control of cell function by neuronal calcium-activated nonselective (CAN) cation channels. (1993) (4)
Resting potential and distribution of muscle fibers in living mammalian mucle. (1961) (4)
Generation of the Membrane Potential (2003) (4)
Corrigendum: A holidic medium for Drosophila melanogaster (2014) (3)
Deregulated mito-nuclear communication alters chromatin plasticity and differentiation potential of mesenchymal stem cells upon ageing (2020) (3)
GABAA receptor mediated inhibition contributes to corticostriatal frequency filtering (2012) (3)
Genes, pathways and metabolism in ageing (2013) (3)
Gene Expression-Based Drug Repurposing to Target Ageing (2018) (3)
The evolution of reproductive strategies : proceedings of a Royal Society Discussion Meeting held on 17 and 18 October 1990 (1991) (3)
A singular view of ageing (2007) (3)
Corrigendum: A holidic medium for Drosophila melanogaster (2014) (3)
Lithium can mildly increase health during ageing but not lifespan in mice (2021) (3)
A spatiotemporal map of the aging mouse brain reveals white matter tracts as vulnerable foci (2023) (3)
Quantitative genetic analysis of natural variation in Drosophila melanogaster (2002) (3)
RATIO IN DROSOPHILA MELANOGASTER (1998) (3)
Analysis and prediction of membrane protein structure (2004) (3)
Behavioural genetics: Molecular genetics meets feeding ecology (1998) (3)
The production of monoclonal antibodies to membrane proteins. (1994) (3)
Ras inhibition by trametinib treatment in Drosophila attenuates gut pathology in females and extends lifespan in both sexes (2018) (3)
Activating transcription factor 4-dependent lactate dehydrogenase activation as a protective response to amyloid beta toxicity (2021) (3)
Nervous System Actions and Interactions (2003) (2)
A mechanism for the control of low-frequency repetitive firing (1982) (2)
Genetics of mate choice (1986) (2)
The Role of GCN2 Kinase in Mediating the Effects of Amino Acids on Longevity and Feeding Behaviour in Drosophila (2022) (2)
A case of mistaken identity in swordtail fish (1987) (2)
CALCIUM INDEPENDENCE OF SLOW CURRENTS UNDERLYING SPIKE FREQUENCY ADAPTATION (1981) (2)
Nervous System Actions and Interactions (2003) (2)
Correction: Inhibition of GSK-3 Ameliorates Aβ Pathology in an Adult-Onset Drosophila Model of Alzheimer's Disease (2012) (2)
c-MYB and TGFb: EMT’s dynamic duo in breast cancer (2012) (2)
Dietary restriction and life-span - Response (2002) (2)
Tetraspanins in zebrafish development (2017) (2)
An experimentalist's approach to the analysis of life history evolution (1989) (2)
Passive and catalytic antibodies and drug delivery (2004) (2)
Cellular Basis and Developmental Timing in a Size Cline of Drosophila me lunogw (2002) (2)
Dietary Restriction: Theory Fails to Satiate Response (2010) (2)
Sisters and Little Saints: One Hundred Years of Primary Carol Cornwall Madsen and Susan Staker Oman (1981) (2)
The preparation and crystallization of Fab fragments of a family of mouse esterolytic catalytic antibodies and their complexes with a transition-state analogue. (2001) (2)
From Reception to Pattern Recognition and Perception (2003) (2)
From Reception to Pattern Recognition and Perception (2003) (2)
Focus on Aging. (2016) (2)
Evolutionary ecology: Different routes to similar ends (1998) (2)
Evolutionary Genetics and Environmental Stress . By A. A. Hoffmann and P. A. Parsons. Oxford University Press. 1991. Pp. ix + 284. Hardback £35. ISBN 0 19 857732 X. (1992) (2)
Cellular Basis and Developmental Timing in a Size Cline of Drosophila m e l u n o g w (2002) (2)
Combined whole-cell and single-channel current measurement with quantitative Ca2+ injection or Fura-2 measurement of Ca2+. (1998) (2)
Myc mouse and anti-ageing therapy (2015) (2)
Fasting , but Not Aging , Dra matically Alters the Redox Status of Cysteine Residues on Proteins in Drosophila melanogaster Graphical Abstract Highlights (2015) (1)
A Computational Model of the Escape Response Latency in the Giant Fiber System of Drosophila melanogaster (2019) (1)
Evolution: Essays in Honour of John Maynard Smith, P.J. Greenwood, P.H. Harvey, M. Slatkin (Eds.). Cambridge University Press, Cambridge (1985), viii (1986) (1)
Colour of success (1983) (1)
Aging of the genome: The dual role of DNA in life and death (2007) (1)
Evolutionary biology: When deviants are favoured: evolution of sex determination (1984) (1)
Drug repurposing for ageing research using model organisms (2016) (1)
Enhancing autophagy by redox regulation extends lifespan in Drosophila (2019) (1)
Graham Bell The Masterpiece of Nature: The Evolution and (1983) (1)
A genetic perspective of Drosophila melanogaster latitudinal body size clines (2002) (1)
Latitudinal variation in competitive ability in Drosophila melanogaster (1998) (1)
Identifying common determinants of lifespan and ageing in model organisms (2002) (1)
Variation in mating behaviour and reproductive success of male Drosophila (1991) (1)
Ageless quest: One scientist's search for genes that prolong youth (2003) (1)
Clinical trials of mTOR inhibitors to boost immunity to viral infection in older adults (2021) (1)
Lithium Promotes Longevi ty through GSK 3 / NRF 2-Dependent Hormesis Graphical (2016) (1)
Author response: Changes of mitochondrial ultrastructure and function during ageing in mice and Drosophila (2017) (1)
Dietary Restriction: Standing Up for Sirtuins Response (2010) (1)
Current work with the voltage clamp (1974) (1)
Nervous System Actions and Interactions: Concepts in Neurophysiology (2003) (1)
Nervous System Actions and Interactions: Concepts in Neurophysiology (2003) (1)
Motor control and the myotatic reflex. (1961) (1)
Induction frequency affects cortico-striatal synaptic plasticity with implications for frequency filtering (2014) (1)
The evolution and Genetics of behaviour. (1979) (1)
Selectivity by Accessory Structures (2003) (1)
Selectivity by Accessory Structures (2003) (1)
Workshop on Assessment of Respiratory Control in Humans: IV. Measurement of the Electrical Activity in Respiratory Muscles (2015) (1)
A rate signal interpreter. (1965) (1)
The role of the cerebellum in stretch responses and the initiation of movement. (1962) (1)
Alteration of Membrane Potential (2003) (1)
Alteration of Membrane Potential (2003) (1)
Phenobarbital: a locus of action on spike broadening and potassium inactivation. (1987) (1)
Book reviewHuman Mating Patterns, C.G.N. Mascie-Taylor, A.J. Boyce (Eds.), in: Society for the Study of Human Biology Symposium Series, 28, Cambridge University Press, Cambridge (1988), p. vii (1989) (1)
Comments from the new Editor (2011) (1)
A role for CD63 in signal transduction (1996) (1)
Correction to: A role for tetraspanin proteins in regulating fusion induced by Burkholderia thailandensis (2020) (1)
From mutation to mechanism: deciphering the molecular function of genetic variants linked to human ageing (2021) (1)
Erratum: Human monoclonal antibodies against a plethora of viral pathogens from single combinatorial libraries (Proceedings of the National Academy of Sciences of the United States of America (May 1, 1993) 90:9 (4141-4145)) (1994) (1)
Molecular inhibition of RAS signalling to target ageing and age-related health (2022) (1)
Characterization of a monoclonal antibody recognizing a novel leucocyte adhesion molecule. (1990) (1)
Ageing-associated changes in transcriptional elongation influence longevity (2023) (1)
Autophagy in healthy ageing and disease (2021) (1)
Immunodeficiency Virus Type 1 of the Infection of Macrophages by Human Tetraspanin Proteins Are Potent Inhibitors Recombinant Extracellular Domains of (2006) (1)
Initial characterization of an anti-actin monoclonal antibody (NH3) (1988) (1)
SELECTION ON AGE AT REPRODUCTION IN DROSOPHILA MELANOGASTER : FEMALE MATING FREQUENCY AS A CORRELATED RESPONSE (0)
Information Important to Metazoans (2003) (0)
Information Important to Metazoans (2003) (0)
Mind: A Transition Function (2003) (0)
Mind: A Transition Function (2003) (0)
RPS 25 is required for efficient RAN translation of C 9 orf 72 and other 3 neurodegenerative disease-associated nucleotide repeats 4 5 (2019) (0)
Pseudo-acetylation of multiple sites on human Tau proteins alters Tau phosphorylation and microtubule binding, and ameliorates amyloid beta toxicity (2017) (0)
DIET OPTIMIZATION FOR DR IN DROSOPHILA Copyright 2007 by The Gerontological Society of America Optimization of Dietary Restriction Protocols in Drosophila (2015) (0)
Forever young (2003) (0)
Nutrient-sensing pathways and ageing (2013) (0)
Measurement of Neural Function (2003) (0)
Letter to the Editor (2004) (0)
Measurement of Neural Function (2003) (0)
PATHWAYS THAT MODULATE CALCIUM-ACTIVATED CATION CHANNELS IN NEURONS (1990) (0)
Parkinson’s Disease: Mitochondria Parked at the ER Hit the Snooze Button (2018) (0)
Women in Metabolism: Part 3. (2015) (0)
Simulation in Biomedical Teaching (1972) (0)
Chemical Transmitters and Effectors (2003) (0)
Chemical Transmitters and Effectors (2003) (0)
Gene expression ‐ based drug repurposing to target aging Handan (2018) (0)
Avian genetics. A population and ecological approachEdited byF. Cooke &P. A. Buckley. London: Academic Press (1987). Pp. xvi + 488. Price £40 (1989) (0)
Sensory Receptor Transduction (2003) (0)
Sensory Receptor Transduction (2003) (0)
Different ligand-binding mechanisms used by the two C5a receptors, C5L2 and C5aR (2007) (0)
Tracking dynamic changes in Alzheimer’s disease brain proteome reveals ageing-independent damage in Drosophila (2018) (0)
Sexual identity of enterocytes regulates autophagy to determine intestinal health, lifespan and responses to rapamycin (2022) (0)
Best Practice & Research Clinical Endocrinology & Metabolism (2013) (0)
Independent glial subtypes delay development and extend healthy lifespan upon reduced insulin-PI3K signalling (2020) (0)
Resource Assessing the Mitochondr ial Membrane Potential in Cells and In Vivo using Targeted Click Chemistry and Mass Spectrometry Graphical Abstract Highlights (2016) (0)
Molecular mechanisms and therapeutic strategies in amyotrophic lateral sclerosis caused by C9orf72 mutations (2016) (0)
Study of power exchange in motor control (1986) (0)
Signal handling aspects in the control of muscular activity. (1969) (0)
Dynamic changes in the brain protein 1 interaction network correlates with 2 progression of Aβ42 pathology in 3 Drosophila 4 (2019) (0)
TECHNICAL COMMENT ABSTRACTS (2005) (0)
At least two strategies (1989) (0)
Glycine-alanine dipeptide repeats spread rapidly in a repeat length- and age-dependent manner in the fly brain (2019) (0)
Population biology. A crash course in survival. (1994) (0)
Dietary restriction protects from age-associated DNA methylation and induces epigenetic reprogramming of lipid metabolism (2017) (0)
A comprehensive approach to decipher biological computation to achieve next generation high-performance exascale computing. (2013) (0)
A nutritional memory impairs survival, transcriptional and metabolic response to dietary restriction in old mice (2019) (0)
Evolution of a controller of state! (1988) (0)
The evolution of behavior, Jerram L. Brown. W. W. Norton and Company Inc., New York (1975), Price $15.95 (1976) (0)
A mitochondrial membrane-bridging machinery mediates signal transduction of intramitochondrial oxidation (2021) (0)
Preface/Front Matter (2008) (0)
Functional genomics of plastic and evolutionary responses to thermal stress (2007) (0)
Evolutionary biology. Menopause for thought. (1993) (0)
Preparation of a holidic medium for Drosophila melanogaster (2013) (0)
Internal Transmission of Information (2003) (0)
Internal Transmission of Information (2003) (0)
simulation in biomedical teaching. Introduction. (1972) (0)
State variable models are powerful, not perfect (1991) (0)
Bidirectional nucleolar dysfunction in C9orf72 frontotemporal lobar degeneration (2017) (0)
Some aspects of the morphology of blue tits and coal tits in relation to their behaviour. (1976) (0)
Functional conservation in genes and pathways linking ageing and immunity (2021) (0)
Facilitated glutamate release at Schaffer collateral to CA1 synapses has access to an exclusive population of NMDA receptors (2015) (0)
Abstract of the 68th Meeting (Spring Meeting) 6–9 March 1990, Heidelberg (1990) (0)
Reproductive Tactics. Proceedings of a Royal Society Discussion Meeting (1991) (0)
Neural Dynamic Effects (2003) (0)
Science and politics. (1978) (0)
Neural Dynamic Effects (2003) (0)
Long-term in vivo imaging of Drosophila larvae (2020) (0)
Branched-chain amino acids impact health and lifespan indirectly via amino acid balance and appetite control (2019) (0)
Factors in the interpretation of the electromyogram based on muscle to dynamic nerve signals. (1967) (0)
Author response: Tissue-specific modulation of gene expression in response to lowered insulin signalling in Drosophila (2021) (0)
Genetics of ageing in invertebrates (2002) (0)
To what extent is ageing genetic ? (2012) (0)
Comments from the departing Editor (2016) (0)
The Gravity Discovery Centre: A New Science Education Linked to research at the Frontier of Phyics (2003) (0)
Facing up to the global challenges of ageing (2018) (0)
2003. Superoxide production by Drosophila mitochondria (2003) (0)
Immunological detection of oligonucleosomal DNA: research report (2000) (0)
Luigi Fontana From Yeast to Humans − − Extending Healthy Life Span (2011) (0)
The new science of ageing (2015) (0)
Reduced insulin signaling prevents age-associated decline of the neuronal function in the escape-response pathway of D. melanogaster (2012) (0)
Crystal structure of the Burkholderia Lethal Factor 1 (BLF1) (2011) (0)
Tetraspanin Cd9b plays a role in fertility in zebrafish (2021) (0)
CD9 co-operation with syndecan-1 is required for a major staphylococcal adhesion pathway (2023) (0)
New strategies for the generation of catalytic antibodies. (1993) (0)
Reply: Glial mitochondropathy in infantile neuroaxonal dystrophy: pathophysiological and therapeutic implications. (2016) (0)
LESGGGWQPGRSLRLSCAASGFTFR TYGMH WVRQAPGKGLEWVA VISYDGSKNYYADSVKG RFTISRDNSKKTLYLQMNSLRAEDTAVYYCAK DFWSGSTKNVFDL GLCHV 14 , LEQSGGGVVQPGRSLRLSCAASGFTFR TYGMH WVRQAPGKGLEWVA VISYDGSKNYYADSVKG RFTISRDNSKKTLYLQMNSLRAEDTAVYYCAK DFWSGSTKNVFDL GLCMV 12 LEQSGAELKRPWSSVKVSCKASGGTLR STAVN WVRQPPGQGLEWMGG LIPL (0)
A role for lithium in rescuing amyloid beta pathology in an inducible drosophila model of Alzheimer’s disease (2015) (0)
Oxidative damage and the neuropathology of Alzheimer's disease in Drosophila (2010) (0)
The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog (2003) (0)
Author response: Matriptase activation of Gq drives epithelial disruption and inflammation via RSK and DUOX (2021) (0)
Frequency-dependent selection : proceedings of a Royal Society Discussion Meeting held on 24 and 25, June, 1987 (1988) (0)
The quest to slow ageing through drug discovery (2020) (0)
Insulin signalling, oxidative stress and aging (2007) (0)
DAAs treatment is associated with up-regulation of CD81 on peripheral B-lymphocytes (2020) (0)
Bidirectional nucleolar dysfunction in C 9 orf 72 patient brain with frontotemporal lobar degeneration (2017) (0)
Ageing: A biomedical perspective: by D. Bellamy Wiley, 1995. £39.95 hbk (i + 410 pages) ISBN 0 471 92067 3 (1996) (0)
Monoclonal antibody UJ 127 . 11 recognizes the human homologue of mouse L 1 cell adhesion molecule (2009) (0)
Crystal Structure Of The Fab Fragment of Esterolytic Antibody MS5-393 (2003) (0)
Matriptase activation of Gq drives epithelial disruption and inflammation via RSK and DUOX (2021) (0)
Mammalian Life Span Ribosomal Protein S 6 Kinase 1 Signaling Regulates (2009) (0)
Matriptase generates a tissue damage re- sponse via promoting Gq signalling, leading to RSK and DUOX activation Running Title: Matriptase activation of a tissue damage response (2021) (0)
Characterization of a monoclonal antibody (DA1) which reacts with bone matrix and bone cell cytoplasm (1987) (0)
1.22 ANGSTROM RESOLUTION CRYSTAL STRUCTURE OF THE FAB FRAGMENT OF ESTEROLYTIC ANTIBODY MS6-12 (2003) (0)
Aging and evolutionary medicine (2007) (0)
Increased Glucose Transport into Neurons Rescues A beta Toxicity in Drosophila (vol 26, pg 2291, 2016) (2016) (0)
High Resolution Crystal Structure Of The Fab Fragment of The Esterolytic Antibody MS6-126 (2003) (0)
Nutrient Sensing Pathways and Ageing (2012) (0)
enzymes and lipid peroxidation in developing mice Modulations by dietary restriction on antioxidant (2015) (0)
CD9 tetraspanins convey robustness to CXCR4b signalling during collective cell migration (2021) (0)
A human monoclonal antiendothelial cell autoantibody uses a VH gene associated with an anti-DNA autoantibody. (1997) (0)
Turn back time (2008) (0)
Session 18: The immunobiology of sepsis (2004) (0)
IDENTIFICATION OF POTENTIAL LIGANDS FOR CD63 FROM RANDOM PEPTIDE LIBRARIES: OM117 (1996) (0)
P1-066: Dietary restriction delays ageing, but not neuronal pathology, in drosophila models of Alzheimer's disease (2008) (0)
SCREENING FOR MODIFIERS OF C9ORF72 HEXANUCLEOTIDE REPEAT EXPANSION TOXICITY IN DROSOPHILA (2017) (0)
Gba1 deletion causes immune hyperactivation and microbial dysbiosis through autophagic defects (2022) (0)
Repurposing Drugs to Ameliorate Aging (2017) (0)
HIGH RESOLUTION CRYSTAL STRUCTURE OF THE COMPLEX OF THE FAB FRAGMENT OF ESTEROLYTIC ANTIBODY MS6-12 AND A TRANSITION-STATE ANALOG (2003) (0)
DIRECTIONAL SELECTION IN DROSOPHILA MELANOGASTER (1990) (0)
Matriptase generates a tissue damage response via promoting Gq signalling, leading to RSK and DUOX activation (2021) (0)
When evolution cannot go into reverse (1987) (0)
In vivo measurement of mitochondrial H2O2 using a ratiometric mass spectrometry probe shows an increase with aging that does not determine lifespan (2011) (0)
Chemical analysis of aging: testing predictions from green theory (2011) (0)
Inhibition of S6K lowers age-related inflammation and immunosenescence and increases lifespan through the endolysosomal system (2022) (0)
Horizons in the evolution of aging (2018) (0)
Aβ toxicity rescued by protein retention in the ER (2021) (0)
Reduced insulin signalling in Drosophila glia reduces ageing phenotypes and extends lifespan (2017) (0)
A combined lifestyle intervention induces a sensitization of the blood transcriptomic response to a nutrient challenge (2021) (0)
Role of the mitochondrial protein LRPPRC2 in Drosophila melanogaster (2013) (0)
Reduced insulin signaling in neurons induces sex-specific health benefits (2022) (0)
Author response: Enhanced insulin signalling ameliorates C9orf72 hexanucleotide repeat expansion toxicity in Drosophila (2021) (0)
Plum is a novel regulator of synaptic function and muscle size in D. melanogaster (2018) (0)
A TORC 1-histone axis regulates chromatin organisation and non-canonical 1 induction of autophagy to ameliorate ageing 2 3 (0)
Biological mechanisms of aging predict age-related disease multimorbidities in patients (2021) (0)
Jerram L. Brown The evolution of behavior (1976) (0)
A paradox for biology. (1991) (0)
pGluAβ increases accumulation of Aβ in vivo and exacerbates its toxicity (2016) (0)
Evolutionary Biology: of cuckoo clocks and cowbirds. (1988) (0)
Kindred spirits (1992) (0)
Full geroprotection from brief rapamycin treatment by persistently increased intestinal autophagy (2022) (0)
Let us accept a “controlled trade-off” model of motor control (1995) (0)
Parallel roles of insulin and TOR signalling in epidermal wound healing (2016) (0)
Messages from a Non-Pest Fruit Fly (2020) (0)
Author response: A TORC1-histone axis regulates chromatin organisation and non-canonical induction of autophagy to ameliorate ageing (2021) (0)
Crystal Structure Of The Complex Of The Fab fragment of Esterolytic Antibody MS5-393 and A Transition-State Analog (2003) (0)
A novel computational approach for predicting complex phenotypes in Drosophila (starvation-sensitive and sterile) by deriving their gene expression signatures from public data (2020) (0)
Short communication Cocaine inhibits 5-HT 3 receptor function in neurons from transgenic mice overexpressing the receptor (2003) (0)
Branched chain amino acids impact health and lifespan indirectly via amino acid balance (2019) (0)
Neural Network Operations (2003) (0)
A courtship advantage for small males in Drosophila melanogaster. (1988) (0)
Generation of a Sinusoidal Waveform from a Sawtooth Waveform (1968) (0)
A NOVEL MODEL OF GBA1-ASSOCIATED PARKINSON'S DISEASE IMPLICATES AUTOPHAGY (2016) (0)
Evolutionary biology. What the sperm count costs. (1992) (0)
Neural Network Operations (2003) (0)

This paper list is powered by the following services:

Other Resources About Linda Partridge

What Schools Are Affiliated With Linda Partridge?

Linda Partridge is affiliated with the following schools:

Linda Partridge's Academic­Influence.com Rankings

Why Is Linda Partridge Influential?

Linda Partridge's Published Works

Published Works

Other Resources About Linda Partridge

What Schools Are Affiliated With Linda Partridge?

Image Attributions

Linda Partridge's AcademicInfluence.com Rankings