Russell Doolittle

Russell Doolittle's AcademicInfluence.com Rankings

Russell Doolittle

Biology

#457

World Rank

#814

Historical Rank

#272

USA Rank

Biochemistry

#72

World Rank

#92

Historical Rank

#44

USA Rank

biology Degrees

Download Badge

Biology

Russell Doolittle's Degrees

PhD Biochemistry University of California, San Diego
Bachelors Chemistry University of California, Berkeley

Why Is Russell Doolittle Influential?

(Suggest an Edit or Addition)

According to Wikipedia, Russell F. Doolittle was an American biochemist who taught at the University of California, San Diego . Described as a "world-renowned evolutionary biologist", Doolittle's research primarily focused on the structure and evolution of proteins. Highlights of Doolittle's decades of research include his role in co-developing the hydropathy index and determining the structure of fibrinogen.

(See a Problem?)

Russell Doolittle's Published Works

Number of citations in a given year to any of this author's works

Total number of citations to an author for the works they published in a given year. This highlights publication of the most important work(s) by the author

Published Works

A simple method for displaying the hydropathic character of a protein. (1982) (20400)
Simian sarcoma virus onc gene, v-sis, is derived from the gene (or genes) encoding a platelet-derived growth factor. (1983) (1366)
Progressive sequence alignment as a prerequisitetto correct phylogenetic trees (2007) (957)
Fibrinogen and fibrin. (1981) (800)
Similar amino acid sequences: chance or common ancestry? (1981) (729)
Determining Divergence Times of the Major Kingdoms of Living Organisms with a Protein Clock (1996) (585)
The multiplicity of domains in proteins. (1995) (526)
Of urfs and orfs : a primer on how to analyze devised amino acid sequences (1986) (514)
Origins and Evolutionary Relationships of Retroviruses (1989) (496)
Six unidentified reading frames of human mitochondrial DNA encode components of the respiratory-chain NADH dehydrogenase (1985) (471)
Fibrinogen and fibrin. (1984) (413)
Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin (1997) (393)
Computer analysis of retroviral pol genes: assignment of enzymatic functions to specific sequences and homologies with nonviral enzymes. (1986) (392)
Determining divergence times with a protein clock: update and reevaluation. (1997) (382)
Homology among DNA-binding proteins suggests use of a conserved super-secondary structure (1982) (364)
Repetitive segmental structure of the transducin beta subunit: homology with the CDC4 gene and identification of related mRNAs. (1986) (357)
Convergent evolution: the need to be explicit. (1994) (342)
Progressive alignment and phylogenetic tree construction of protein sequences. (1990) (338)
Structural aspects of the fibrinogen to fibrin conversion. (1973) (335)
URF6, last unidentified reading frame of human mtDNA, codes for an NADH dehydrogenase subunit. (1986) (323)
Crystal structure of human fibrinogen. (2009) (316)
Evolution by acquisition: the case for horizontal gene transfers. (1992) (300)
- cross-linking sites in human and bovine fibrin. (1971) (276)
Human melanoma-associated antigen p97 is structurally and functionally related to transferrin (1982) (274)
Synthetic peptide derivatives that bind to fibrinogen and prevent the polymerization of fibrin monomers. (1978) (272)
Studies on synthetic peptides that bind to fibrinogen and prevent fibrin polymerization. Structural requirements, number of binding sites, and species differences. (1980) (268)
The amino acid sequence of the α-chain of human fibrinogen (1979) (260)
Proposed acquisition of an animal protein domain by bacteria. (1992) (225)
Phylogeny determined by protein domain content. (2005) (225)
Amino acid sequence studies on factor XIII and the peptide released during its activation by thrombin. (1974) (222)
“Homology” in proteins and nucleic acids: A terminology muddle and a way out of it (1987) (219)
Homology between the DNA-binding domain of the GCN4 regulatory protein of yeast and the carboxyl-terminal region of a protein coded for by the oncogene jun. (1987) (214)
A model of fibrin formation based on crystal structures of fibrinogen and fibrin fragments complexed with synthetic peptides. (2000) (207)
Antibodies specific for the carboxy- and amino-terminal regions of simian virus 40 large tumor antigen. (1980) (207)
Structure and expression of a complementary DNA for the nuclear coded precursor of human mitochondrial ornithine transcarbamylase. (1984) (196)
Antibody Active Sites and Immunoglobulin Molecules (1966) (193)
The Future of Life (2002) (182)
Crystal structure of fragment double-D from human fibrin with two different bound ligands. (1998) (175)
Drosophila kelch motif is derived from a common enzyme fold. (1994) (175)
Amino acid sequence studies on artiodactyl fibrinopeptides. I. Dromedary camel, mule deer, and cape buffalo. (1967) (172)
Amino-Acid Sequence Investigations of Fibrinopeptides from Various Mammals: Evolutionary Implications (1964) (169)
Computer-based characterization of epidermal growth factor precursor (1984) (169)
Phase variation: evolution of a controlling element. (1980) (168)
Molecular evolution: computer analysis of protein and nucleic acid sequences. (1990) (162)
Nucleotide sequence and formation of the transforming gene of a mouse sarcoma virus (1981) (161)
Sequence comparisons of retroviral proteins: relative rates of change and general phylogeny. (1988) (160)
The genealogy of some recently evolved vertebrate proteins (1985) (159)
Domainal evolution of a prokaryotic DNA repair protein and its relationship to active-transport proteins (1986) (155)
Angiotensinogen is related to the antitrypsin-antithrombin-ovalbumin family. (1983) (153)
Designation of sequences involved in the "coiled-coil" interdomainal connections in fibrinogen: constructions of an atomic scale model. (1978) (148)
Crystal structure of native chicken fibrinogen at 2.7 A resolution. (2001) (146)
Of urfs and orfs (1986) (144)
Microbial genomes opened up (1998) (144)
The evolution of vertebrate blood coagulation as viewed from a comparison of puffer fish and sea squirt genomes (2003) (140)
Climate change and the integrity of science. (2010) (137)
Identification of a region of human fibrinogen interacting with staphylococcal clumping factor. (1982) (137)
Evolutionarily mobile modules in proteins. (1993) (134)
gamma and alpha chains of human fibrinogen possess sites reactive with human platelet receptors. (1982) (133)
Pyrrolidonyl peptidase. An enzyme for selective removal of pyrrolidonecarboxylic acid residues from polypeptides. (1968) (133)
Progressive alignment of amino acid sequences and construction of phylogenetic trees from them. (1996) (132)
Amino acid sequence studies on plasmin-derived fragments of human fibrinogen: amino-terminal sequences of intermediate and terminal fragments. (1975) (123)
Differential specificities of the thrombin, plasmin and trypsin with regard to synthetic and natural substrates and inhibitors. (1972) (122)
A comparison of evolutionary rates of the two major kinds of superoxide dismutase (1992) (120)
Protein Evolution (1968) (120)
Aligning amino acid sequences: Comparison of commonly used methods (1985) (117)
Evolution and relatedness in two aminoacyl-tRNA synthetase families. (1991) (116)
Evolution of the contact phase of vertebrate blood coagulation (2008) (107)
THE STRUCTURE AND EVOLUTION OF VERTEBRATE FIBRINOGEN (1983) (102)
A detailed consideration of a principal domain of vertebrate fibrinogen and its relatives (1992) (97)
Searching through sequence databases. (1990) (96)
Sugar permeases of the bacterial phosphoenolpyruvate‐dependent phosphotransferase system: sequence comparisons (1988) (96)
Reconstructing history with amino acid sequences 1 (1992) (95)
Step-by-step evolution of vertebrate blood coagulation. (2009) (91)
Nearest neighbor procedure for relating progressively aligned amino acid sequences. (1990) (89)
Relationships of human protein sequences to those of other organisms. (1986) (89)
Studies of invertebrate fibrinogen. II. Transformation of lobster fibrinogen into fibrin. (1971) (87)
The origins and evolution of eukaryotic proteins. (1995) (85)
Blood coagulation in fish. (1962) (85)
Redundancies in Protein Sequences (1989) (82)
Intron Distribution in Ancient Paralogs Supports Random Insertion and Not Random Loss (1997) (82)
Evolutionary anomalies among the aminoacyl-tRNA synthetases. (1998) (78)
Identification of the polypeptide chains involved in the cross-linking of fibrin. (1969) (78)
Amino acid sequence studies on the alpha chain of human fibrinogen. Exact location of cross-linking acceptor sites. (1979) (78)
Presence of a vertebrate fibrinogen-like sequence in an echinoderm. (1990) (77)
Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide. (1999) (77)
Studies of invertebrate fibrinogen. I. Purification and characterization of fibrinogen from the spiny lobster. (1971) (77)
Crystal structure of native chicken fibrinogen at 5.5-A resolution. (2000) (75)
Phylogenetic Analysis of the Aminoacyl-tRNA synthetases (1995) (74)
Isolation, characterization, and location of a donor-acceptor unit from cross-linked fibrin. (1970) (72)
Dimeric half-molecules of human fibrinogen are joined through disulfide bonds in an antiparallel orientation. (1983) (72)
Hybrid fibrin: proof of the intermolecular nature of - crosslinking units. (1971) (71)
Reconstructing the evolution of vertebrate blood coagulation from a consideration of the amino acid sequences of clotting proteins. (1987) (71)
Tracing the spread of fibronectin type III domains in bacterial glycohydrolases (1994) (70)
Influence of calcium ion on the binding of fibrin amino terminal peptides to fibrinogen. (1981) (70)
A naturally occurring horizontal gene transfer from a eukaryote to a prokaryote (1990) (67)
CHARACTERIZATION OF LAMPREY FIBRINOPEPTIDES. (1965) (67)
Official and tentative methods of analysis of the association of official agricultural chemists (65)
Amino acid sequence studies on the alpha chain of human fibrinogen. Overlapping sequences providing the complete sequence. (1979) (64)
Amino acid sequence studies on the alpha chain of human fibrinogen. Covalent structure of the alpha-chain portion of fragment D. (1977) (63)
Homology between the glycoproteins of vesicular stomatitis virus and rabies virus (1982) (62)
Correlating structure and function during the evolution of fibrinogen‐related domains (2012) (61)
Antibodies Against Synthetic Peptides (1983) (60)
Photoaffinity labeling of the primary fibrin polymerization site: isolation and characterization of a labeled cyanogen bromide fragment corresponding to gamma-chain residues 337-379. (1992) (58)
Amino acid sequence of the beta chain of human fibrinogen. (1979) (57)
Evolutionary aspects of whole-genome biology. (2005) (56)
Structure of fragment E species from human cross-linked fibrin. (1981) (56)
Amino acid sequence studies on the alpha chain of human fibrinogen. Location of four plasmin attack points and a covalent cross-linking site. (1975) (56)
Amino acid sequence homology between polyoma and SV40 tumour antigens deduced from nucleotide sequences (1978) (55)
Characterization, primary structure, and evolution of lamprey plasma albumin (1992) (54)
The amino-terminal sequence of lobster fibrinogen reveals common ancestry with vitellogenins. (1990) (54)
Retrovirus phylogeny and evolution. (1990) (54)
SYNTHETIC PEPTIDES MODELED ON FIBRIN POLYMERIZATION SITES (1983) (54)
Antibodies against synthetic peptides reveal that the unidentified reading frame A6L, overlapping the ATPase 6 gene, is expressed in human mitochondria (1983) (53)
Isolation, characterization, and synthesis of peptides from human fibrinogen that block the staphylococcal clumping reaction and construction of a synthetic clumping particle. (1982) (53)
Amino acid sequence studies on artiodactyl fibrinopeptides: II. Vicuna, elk, muntjak, pronghorn antelope, and water buffalo (1967) (53)
Amino acid sequence studies on the alpha chain of human fibrinogen. Characterization of 11 cyanogen bromide fragments. (1977) (53)
Species differences in the interaction of thrombin and fibrinogen. (1962) (52)
Molecular cloning of a new cDNA and expression of 3-hydroxy-3-methylglutaryl-CoA synthase gene from Hevea brasiliensis (2005) (51)
Coagulation in Vertebrates with a Focus on Evolution and Inflammation (2010) (51)
Photoaffinity labeling of the primary fibrin polymerization site: localization of the label to gamma-chain Tyr-363. (1992) (51)
A NEW CLASS OF BLOOD COAGULATION INHIBITORS. (1963) (51)
Biodiversity: Microbial genomes multiply (2002) (50)
Amino acid sequence of the beta chain of human fibrinogen: homology with the gamma chain. (1978) (50)
Evidence for the Heterolobosea from Phylogenetic Analysis of Genes Encoding Glyceraldehyde‐3‐Phosphate Dehydrogenase (1996) (50)
Computer methods for macromolecular sequence analysis (1996) (49)
Binding of synthetic B knobs to fibrinogen changes the character of fibrin and inhibits its ability to activate tissue plasminogen activator and its destruction by plasmin. (2006) (48)
Fibronectin type III modules in the receptor phosphatase CD45 and tapeworm antigens (1993) (46)
Genomic Evidence for a Simpler Clotting Scheme in Jawless Vertebrates (2008) (46)
Searching for the common ancestor. (2000) (45)
Three-dimensional structural studies on fragments of fibrinogen and fibrin. (1998) (45)
The amino acid sequence of a 27-residue peptide released from the alpha-chain carboxy-terminus during the plasmic digestion of human fibrinogen. (1976) (44)
Similar amino acid sequences revisited. (1989) (44)
A relationship between the yeast cell cycle genes CDC4 and CDC36 and the ets sequence of oncogenic virus E26 (1984) (43)
Relocation of a protease-like gene segment between two retroviruses. (1987) (43)
Structural basis of the fibrinogen-fibrin transformation: contributions from X-ray crystallography. (2003) (43)
DIFFERENCES IN THE CLOTTING OF LAMPREY FIBRINOGEN BY LAMPREY AND BOVINE THROMBINS. (1965) (43)
Platelet and Plasma Fibrinogens Are Identical Gene Products (1974) (42)
Pyrrolidonecarboxylyl peptidase: stabilization and purification. (1969) (42)
Lamprey fibrinogen gamma chain: cloning, cDNA sequencing, and general characterization. (1985) (42)
Natively unfolded regions of the vertebrate fibrinogen molecule (2005) (41)
Identification of the polypeptides encoded in the ATPase 6 gene and in the unassigned reading frames 1 and 3 of human mtDNA. (1983) (41)
Crystal Structure Studies on Fibrinogen and Fibrin (2001) (41)
The sequence of amino acids at the N-terminal end of bovine fibrinopeptide B. (1963) (40)
Bacterial actins? An evolutionary perspective. (2002) (40)
The simian—human connection (1989) (39)
Identification of the polypeptides encoded in the unassigned reading frames 2, 4, 4L, and 5 of human mitochondrial DNA. (1986) (39)
INTERACTION OF FIBRINOGEN WITH STAPHYLOCOCCAL CLUMPING FACTOR AND WITH PLATELETS * (1983) (39)
Sodium dodecyl sulfate-polyacrylamide gel electrophoresis studies on lobster fibrinogen and fibrin. (1972) (37)
Osmotic Pressure and Aqueous Humor Formation in Dogfish (1960) (37)
Crystallization of fragment D from human fibrinogen (1995) (36)
The formation of crosslinked fibrins: Evidence for the involvement of lysine ε-amino groups (1966) (36)
TRF2 and the evolution of the bilateria (2014) (36)
More molecular opportunism (1988) (36)
Molecular cloning of silkworm (Bombyx mori) antichymotrypsin. A new member of the serpin superfamily of proteins from insects. (1993) (36)
Seven unidentified reading frames of human mitochondrial DNA encode subunits of the respiratory chain NADH dehydrogenase. (1986) (35)
Determination of the relative positions of amino acids by partial specific cleavages of end-labeled proteins. (1985) (35)
The evolution of the vertebrate plasma proteins (1987) (34)
Tracing the origin of retroviruses. (1992) (32)
cDNA sequence of a second fibrinogen alpha chain in lamprey: an archetypal version alignable with full-length beta and gamma chains. (1992) (32)
CORRELATION OF THE MODE OF FIBRIN POLYMERIZATION WITH THE PATTERN OF CROSS‐LINKING * (1972) (32)
An Attempt to Pinpoint the Phylogenetic Introduction of Glutaminyl-tRNA Synthetase Among Bacteria (1999) (30)
The amino acid sequence of the alpha-chain of human fibrinogen. (1979) (30)
A bug with excess gastric avidity (1997) (30)
Molecular biology of fibrinogen and fibrin (1983) (30)
Converting Amino Acid Alignment Scores into Measures of Evolutionary Time: A Simulation Study of Various Relationships (1997) (30)
A putative nitrogenase reductase gene found in the nucleotide sequences from the photosynthetic gene cluster of R. capsulata (1985) (29)
Amino acid sequences of lamprey fibrinopeptides A and B and characterizations of the junctions split by lamprey and mammalian thrombins. (1976) (29)
Amino acid sequence studies on fibrinopeptides from several species. (1963) (28)
Amino acid sequence of the carboxy-terminal cyanogen bromide peptide of the human fibrinogen β-chain: Homology with the corresponding γ-chain peptide and presence in fragment D (1975) (28)
26A. Crystal structure of a recombinant ??EC domain from human fibrinogen-420 (1998) (28)
Human fibrinogen: anticipating a 3‐dimensional structure (1996) (27)
The synthetic peptide Gly‐Pro‐Arg‐Pro‐amide limits the plasmic digestion of fibrinogen in the same fashion as calcium ion (1992) (27)
Amino acid sequence studies on the alpha chain of human fibrinogen. Isolation and characterization of two linked alpha-chained cyanogen bromide fragments from fully cross-linked fibrin. (1977) (27)
Of archae and eo: what's in a name? (1995) (26)
Pyrrolidonecarboxylyl peptidase: studies on the specificity of the enzyme. (1969) (26)
Evolution of Immunoglobulin Polypeptide Chains: Carboxy-Terminal of an IgM Heavy Chain (1966) (26)
Primate fibrinopeptides: Evolutionary significance (1972) (25)
The comings and goings of homing endonucleases and mobile introns. (1993) (25)
cDNA sequences of two apolipoproteins from lamprey. (1987) (25)
Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini. (2007) (25)
Biotechnology--the enormous cost of success. (1991) (25)
3 – Fibrinogen and Fibrin (1975) (25)
Shadow-cast electron microscopy of fibrinogen with antibody fragments bound to specific regions. (1981) (25)
[38] Pyrrolidonecarboxylyl peptidase (1970) (24)
Stein and Moore Award address. Reconstructing history with amino acid sequences. (1992) (24)
The amino-terminal amino acid sequences of rabbit immunoglobulin light chains. (1966) (24)
Complementary DNA sequence of lamprey fibrinogen beta chain. (1986) (24)
CRYSTAL STRUCTURE OF NATIVE CHICKEN FIBRINOGEN (2000) (23)
Light Chains of Rabbit Immunoglobulin: Assignment to the Kappa Class (1967) (22)
Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide. (2002) (22)
The structure and evolution of vertebrate fibrinogen: a comparison of the lamprey and mammalian proteins. (1990) (22)
The arrangement of disulfide bonds in fragment D from human fibrinogen. (1978) (22)
[18] Terminal pyrrolidonecarboxylic acid: Cleavage with enzymes. (1972) (22)
Evolution of vertebrate fibrin formation and the process of its dissolution. (1997) (21)
Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms. (2009) (21)
1 – Protein Evolution (1979) (21)
Antibodies against the COOH-terminal undecapeptide of subunit II, but not those against the NH2-terminal decapeptide, immunoprecipitate the whole human cytochrome c oxidase complex. (1986) (21)
ON THE PROPERTIES OF A NEW HUMAN FIBRINOPEPTIDE. (1963) (20)
Searching for differences between fibrinogen and fibrin that affect the initiation of fibrinolysis. (2008) (20)
A simple solid-phase amino acid sequencer employing a thioacetylation stepwise degradation procedure. (1977) (20)
Counting and discounting the universe of exons. (1991) (20)
Sequence homologies amongE. coli ribosomal proteins: Evidence for evolutionarily related groupings and internal duplications (1980) (19)
Complete sequence of the lamprey fibrinogen alpha chain. (1989) (19)
The crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface. (2002) (19)
The amino acid sequences of those portions of human fibrinogen fragment E which are not included in the amino-terminal disulfide knot. (1975) (18)
Presence of a Fibronectin Type III Domain in a Plant Protein (1998) (18)
Amino acid sequence studies on the alpha chain of human fibrinogen. Complete sequence of the largest cyanogen bromide fragment. (1979) (18)
The Evolution of Vertebrate Fibrinogen (1976) (18)
Do you dig my groove? (1999) (16)
Differences in binding specificity for the homologous gamma- and beta-chain "holes" on fibrinogen: exclusive binding of Ala-His-Arg-Pro-amide by the beta-chain hole. (2006) (16)
The Occurrence of Type S1A Serine Proteases in Sponge and Jellyfish (2002) (15)
Some comparative aspects of the fibrinogen-fibrin conversion. (1963) (15)
Quantitative determination of amino-terminal amino acids in crosslinked and non-crosslinked fibrin. (1967) (15)
A method for the simultaneous alignment of three or more amino acid sequences (2005) (15)
Similar AminoAcidSequences: Chance orCommonAncestry? (1981) (15)
Identity of Chimpanzee with Human Fibrinopeptides (1970) (14)
Amino acid compositions of the subunit chains of lamprey fibrinogen. Evolutionary significance of some structural anomalies. (1976) (14)
Gene Transfers Between Distantly Related Organisms (2003) (14)
Clotting of mammalian fibrinogens by papain: a re-examination. (2014) (13)
Some reflections on the early days of sequence searching. (1997) (13)
Crystal structure of a recombinant alphaEC domain from human fibrinogen-420. (1998) (13)
Evolution of the fibrinogen γ′ chain: implications for the binding of factor XIII, thrombin and platelets (2009) (13)
The subunit structure of lamprey fibrinogen and fibrin. (1974) (12)
Crystal Structures of Fragments D and Double-D from Fibrinogen and Fibrin (1999) (11)
Tryptic peptides from the active sites of antibody molecules. (1965) (11)
Sequencing Peptides and Proteins Lacking Free α-Amino Groups (1977) (11)
The conversion of fibrinogen to fibrin: A brief history of some key events. (2017) (11)
Protein sequence comparisons: searching databases and aligning sequences. (1994) (11)
Determining divergence times with protein clocks. (1999) (10)
Dating the Cenancester of Organisms (1996) (10)
The parasite genome: The grand assault (2002) (10)
Bioinformatic Characterization of Genes and Proteins Involved in Blood Clotting in Lampreys (2015) (10)
Construction of a facsimile data set for large genome sequence analysis. (1990) (10)
Immunodeficiency viruses: the simian-human connection. (1989) (10)
The Roots of Bioinformatics in Protein Evolution (2010) (10)
Lamprey fibrinopeptide B is a glycopeptide. (1974) (10)
Sialic Acid from Blood Cells of the Lamprey Eel (1962) (9)
Some Important Milestones in the Field of Blood Clotting (2015) (9)
Gibbon Fibrinopeptides: Identification of a Glycine-Serine Allelism at Position B-3 (1970) (9)
Reconstructing history with amino acid sequences (2002) (9)
On the trail of protein sequences (2000) (9)
Ribosomal protein S1 is the product of a series of contiguous duplications (1982) (9)
Anomalous phylogeny involving the enzyme glucose-6-phosphate isomerase (1992) (8)
Preliminary report on the amino acid sequence of the α-chain of human fibrinogen (1979) (8)
Further Studies on Clotting and Fibrinolysis in Plasma from the Smooth Dogfish (Mustelis canis) (1963) (8)
The amino acid sequence of the carboxy-terminal 142 amino acids of the alpha-chain of human fibrinogen. (1978) (8)
Self-induced crosslinking of factor XIII. (1973) (8)
CRYSTAL STRUCTURE OF FIBRINOGEN FRAGMENT D (1997) (7)
The minor form alpha' chain from lamprey fibrinogen is rapidly crosslinked during clotting. (1995) (7)
Response: Dating the Cenancester of Organisms (1996) (7)
Characterization of fibrinopeptides A and B from a drill (Mandrillus leucophaeus). (1969) (7)
Some notes on crystallizing fibrinogen and fibrin fragments. (2002) (7)
Amino Acid Sequence Studies on the γ-Chain of Human Fibrinogen (1977) (6)
Peptide-derivatized albumins that inhibit fibrin polymerization. (2011) (6)
Structure and function of fibrinogen. (1977) (6)
Hominoid evolution as judged by fibrinopeptide structures (2005) (6)
The Protochordate Ciona intestinalis Has a Protein Like Full-Length Vertebrate Fibrinogen (2011) (6)
Gly-Pro-Arg-Pro derivatives that bind to human plasma albumin and prevent fibrin formation. (1986) (5)
Sequence of amino acids comprising the single intra-chain disulfide loop in the alpha-chain of human fibrinogen. (1978) (5)
Differences in Binding Specificity for the Homologous γ-and â-Chain “ Holes ” on Fibrinogen : Exclusive Binding of Ala-His-Arg-Pro-amide by the â-Chain Hole † (5)
Peripheral metabolism of parathyroid hormone (1980) (5)
Mammalian Phylogeny Based on Fibrinopeptide Amino Acid Sequences (1973) (4)
Sequences and topology—An inverse approach to the old folding problem: Editorial overview (1992) (4)
2 – Protein Sequence Data Banks: The Continuing Search for Related Structures (1973) (4)
Structural and Functional Diversity of Fibrinogen-Related Domains (2016) (4)
Photoaffinity labeling of the primary fibrin polymerization site : Localization of the label to y-chain Tyr-363 ( fibrinogen / fragment D ) (4)
Step-wise degradation of peptides attached to solid supports. (1977) (3)
More homologies among the vertebrate plasma proteins (1985) (3)
An Anecdotal Account of the History of Peptide Stepwise Degradation Procedures (1982) (3)
STRUCTURE OF RECOMBINANT ALPHAEC DOMAIN FROM HUMAN FIBRINOGEN-420 (1998) (3)
Amino acid sequence of the j3 chain of human fibrinogen: Homology with the "y chain (3)
Fibrin Packing Arrangements Inferred from Crystal Structures of Fragments D and Double-D Complexed with Synthetic Peptide Knobs (2000) (3)
6 – Evolution of the Vertebrate Plasma Proteins (1984) (2)
Some symmetry considerations for the fibrinogen-fibrin assembly system. (1974) (2)
A latent inhibitor of fibrin polymerization with ancillary anticoagulant activity. (2000) (2)
Synthesis and thrombolytic properties of some flufenamate derivatives. (1978) (2)
Determining the Relative Rates of Change for Prokaryotic and Eukaryotic Proteins with Anciently Duplicated Paralogs (2000) (2)
CRYSTAL STRUCTURE OF FRAGMENT DOUBLE-D FROM HUMAN FIBRIN WITH THE PEPTIDE LIGAND GLY-HIS-ARG-PRO-AMIDE (1999) (2)
Martin David Kamen (2004) (2)
DOMAINS IN PROTEINS (1995) (2)
Of compact disks and expanded minds (1992) (2)
Crystal structure of native chicken fibrinogen with two different bound ligands (2001) (2)
Unusual non-crystallographic symmetry in crystals of a 420 kDa crustacean clottable protein. (2005) (2)
Amino acid sequence comparison as an aid to determining evolutionary origins (1992) (2)
Building the Salk: Genesis of the Salk Institute by Suzanne Bourgeois (2013) University of California Press, Berkeley, California. (2014) (2)
Book Review: Introduction to protein science: architecture, function and genomics (2005) (2)
Lens proteins. More molecular opportunism. (1988) (2)
Structural Basis of Signaling Events Involving Fibrinogen and Fibrin (2010) (2)
THE STRUCTURES OF FIBRINOGEN AND FIBRIN (1978) (1)
Preliminary report on the amino acid sequence of the alpha-chain of human fibrinogen. (1979) (1)
The molecular constancy of fibrinopeptides A and B from 125 individual humans (1970) (1)
Repetitive segmental structure of the transducin fJ subunit: Homology with the CDC4 gene and identification of related mRNAs (guanine nucleotide regulatory protein/photoreceptor biochemistry/molecular evolution/signal transduction) (2016) (1)
Sequences and topology Editorial overview (1991) (1)
Sequences and topology: Unity and diversity all over again (1993) (1)
Direct measurement of a second fibrinogen alpha chain in lamprey blood plasma. (1992) (1)
Progress in determining the structure of fragment D from human fibrinogen (1996) (1)
The early evolutionary history of proteins (1994) (1)
Screening a lamprey liver cDNA library with oligonucleotide probes based on various plasma proteins (1985) (1)
Kingdoms of Living Organisms with a Protein Clock Determining Divergence Times of the Major (2007) (1)
Correction: Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin (1997) (1)
Overview of the symposium on molecular anthropology. Wayne State University, March 13-14, 1995. (1996) (1)
Symposium OverviewSYMPOSIUM OVERVIEW: Overview of the Symposium on Molecular Anthropology (1996) (1)
Amino-terminal analysis of human fibrinogen treated with estrogenic steroids: failure to support a thrombin-mimetic proteolytic effect. (1975) (1)
The Effect of Some Synthetic Arginyl and Lysyl Compounds on Clotting and Fibrinolysis (1972) (1)
CHAPTER 20 – Structural Basis of Signaling Events Involving Fibrinogen and Fibrin (2003) (0)
Crystal Structure of Fragment D-dimer from Human Fibrin Complexed with Gly-hydroxyPro-Arg-Pro-amide (2007) (0)
Bruno H. Zimm (1920–2005) (2009) (0)
Crystal Structure of Fragment D from Human Fibrinogen Complexed with Gly-hydroxyPro-Arg-Pro-amide (2007) (0)
The Biochemistry of Fibrin Cross-Linking (1977) (0)
Amino acid sequence of the carboxy-terminal cyanogen bromide fragment from bovine and human fibrinogen gamma-chains. (1972) (0)
1. Crystal structures of fragments D and double-D from fibrinogen and fibrin (1998) (0)
Crystal structure of fragment D from Human Fibrinogen Complexed with Gly-Pro-Arg-Pro-amide. (2007) (0)
Fragment Double-D from Human Fibrin (2003) (0)
Clots vs bugs: who's ahead? (2011) (0)
CRYSTAL STRUCTURE OF FRAGMENT DOUBLE-D FROM HUMAN FIBRIN (1999) (0)
Chapter 2 Protein Sorting and Thansport (2015) (0)
Bioinformatic Characterization of Genes and Proteins Involved in Blood Clotting in Lampreys (2015) (0)
Crystal Structure of D-Dimer from Human Fibrin Complexed with Gly-His-Arg-Pro-Tyr-amide (2007) (0)
CONCLUDING REMARKS (1983) (0)
Crystal Structure of Human Fragment D Complexed with Ala-His-Arg-Pro-amide (2006) (0)
In Memoriam: James R. Brown (1930–2011) (2011) (0)
Interactions Of Triphenyl-Methane Compounds With Fibrinogen And Fibrin Monomers (1981) (0)
Epidermal growth factor. (1990) (0)
Immunity. (Book Reviews: The Generation of Antibody Diversity. A New Look) (1977) (0)
S. Jonathan Singer: A man who loved ideas and detested walls (2017) (0)
Multiple Sequence Alignment and Phylogenetic Trees (2004) (0)
CRYSTAL STRUCTURE OF FRAGMENT D FROM HUMAN FIBRINOGEN WITH THE PEPTIDE LIGAND GLY-HIS-ARG-PRO-AMIDE (1999) (0)
CRYSTAL STRUCTURE OF CROSSLINKED FRAGMENT D (1997) (0)
UNIVERSITY OF CALIFORNIA, SAN DIEGO Evolution and Diversification of the Core Transcription Regulatory Network A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Biology by (2015) (0)
OPENING REMARKS (1983) (0)
MLHHLNTTEYL QY ENGKFSKSR GVGVFGNNAQ DSGI SPSVWRYYLASVRP ESSDSHFSWDDFVARNNSELLANL GN Rec . . VPLEHHMFGMMLGK DGKPF KTR AGGTVKLADL LDEA LERARRLVAEKNPDMPADELE KLANAVGIGAVKY AD Ybs TK LVHGEEALRQAIRISEALFSGDIANLTAAEIEQGFKDVPSFVHEGG DVPLVELLVSAGISPSKRQA (0)
Acknowledgement to Reviewers of Life in 2017 (2018) (0)
Printed in Great Britain Ribosomal protein SI is the product of a series of contiguous dupl icat ions (2005) (0)
Immunity: The Generation of Antibody Diversity . A New Look. A. J. Cunningham, Ed. Academic Press, New York, 1976. x, 212 pp., illus. $19.75. (1977) (0)
Determining the crystal structure of fibrinogen - eScholarship (2004) (0)
Fifty years of sequence analysis: what have we learned? (2004) (0)
Isolation And Characterization Of Fragments Of Human Fibrinogen Generated By Chemical Cleavage At Cysteine Residues (1981) (0)
Book reviewThe origin of life by natural causes: M. G. Rutten, Elsevier, Amsterdam, 1971, 420 pp., 150 illus., 27 tab., Dfl. 100.00 (1973) (0)
TRF 2 and the evolution of the bilateria Material (2014) (0)
Biochemical evolution and the origin of life. part II. molecular evolution (1972) (0)
Some comments on John Ferry's most enduring paper. (2004) (0)
Fibrin D-Dimer, Lamprey complexed with the PEPTIDE LIGAND: GLY-HIS-ARG-PRO-AMIDE (2003) (0)
Crystal structure of human D-dimer from cross-linked fibrin complexed with GPR and GHRPLDK peptide ligands. (2003) (0)
Amino Acid Sequence Studies on Human Fibrinogen:Arrangement of Interchain Disulfide Bonds Bounding the Regions of Three-Stranded Ropes (1977) (0)
Forthcoming papers (2004) (0)
Martin David Kamen (27 August 1913 - 31 August 2002). (2004) (0)
ID: 057 Delaying Fibrinolysis with Synthetic Peptides Patterned on Fibrin B Knobs (2006) (0)
PhaseVariation: Evolution ofa Controlling Element (1980) (0)
Sequencing peptides and proteins lacking free alpha-amino groups. (1977) (0)
Amino acid sequence of the carboxy-terminal cyanogen bromide peptide of the human fibrinogen beta-chain: homology with the corresponding gamma-chain peptide and presence in fragment D. (1975) (0)

This paper list is powered by the following services:

Other Resources About Russell Doolittle

en.wikipedia.org

What Schools Are Affiliated With Russell Doolittle?

Russell Doolittle is affiliated with the following schools:

Russell Doolittle's Academic­Influence.com Rankings