Roberto Burioni
#15,512
Most Influential Person Now
Italian virologist
Roberto Burioni's AcademicInfluence.com Rankings
Roberto Burionibiology Degrees
Biology
#586
World Rank
#1037
Historical Rank
Virology
#12
World Rank
#13
Historical Rank
Microbiology
#35
World Rank
#51
Historical Rank
Download Badge
Biology
Roberto Burioni's Degrees
- Bachelors Biology University of Milan
- PhD Molecular Biology University of Milan
Similar Degrees You Can Earn
Why Is Roberto Burioni Influential?
(Suggest an Edit or Addition)According to Wikipedia, Roberto Burioni is an Italian virologist, physician, and academic. A Professor of Microbiology and Virology at the Vita-Salute San Raffaele University, he runs there a lab developing human monoclonal antibodies against human infectious agents, the study of pathogen-host interplay, and the use of molecular tools in the early diagnosis of infectious diseases. A prominent virologist, Burioni has risen to fame in Italy for his strong stance against the antivaccination movement and has been described as the "most famous virologist in Italy".
Roberto Burioni's Published Works
Number of citations in a given year to any of this author's works
Total number of citations to an author for the works they published in a given year. This highlights publication of the most important work(s) by the author
Published Works
- The Era of Molecular and Other Non-Culture-Based Methods in Diagnosis of Sepsis (2010) (346)
- Human monoclonal antibodies against a plethora of viral pathogens from single combinatorial libraries. (1993) (162)
- Molecular diagnosis of sepsis in neutropenic patients with haematological malignancies. (2008) (155)
- Identification of a Broadly Cross-Reacting and Neutralizing Human Monoclonal Antibody Directed against the Hepatitis C Virus E2 Protein (2007) (133)
- Genetic characterization of the stabilizing functions of a region of broad-host-range plasmid RK2 (1990) (117)
- Recombinant human Fab to glycoprotein D neutralizes infectivity and prevents cell-to-cell transmission of herpes simplex viruses 1 and 2 in vitro. (1994) (99)
- Comparative Evaluation of the Bruker Biotyper and Vitek MS Matrix-Assisted Laser Desorption Ionization–Time Of Flight (MALDI-TOF) Mass Spectrometry Systems for Identification of Yeasts of Medical Importance (2013) (85)
- Hepatitis C Virus (HCV) Infection May Elicit Neutralizing Antibodies Targeting Epitopes Conserved in All Viral Genotypes (2009) (71)
- Mini-FLOTAC, Kato-Katz and McMaster: three methods, one goal; highlights from north Argentina (2014) (68)
- Potential Impact of a Microarray-Based Nucleic Acid Assay for Rapid Detection of Gram-Negative Bacteria and Resistance Markers in Positive Blood Cultures (2014) (67)
- A Human Monoclonal Antibody with Neutralizing Activity against Highly Divergent Influenza Subtypes (2011) (61)
- Dissection of human humoral immune response against hepatitis C virus E2 glycoprotein by repertoire cloning and generation of recombinant fab fragments (1998) (61)
- Chimeric antigen receptor (CAR)-engineered T cells redirected against hepatitis C virus (HCV) E2 glycoprotein (2015) (60)
- A potential role for monoclonal antibodies in prophylactic and therapeutic treatment of influenza. (2011) (55)
- Monoclonal antibodies isolated from human B cells neutralize a broad range of H1 subtype influenza A viruses including swine-origin Influenza virus (S-OIV). (2010) (53)
- Mapping B-Cell Epitopes of Hepatitis C Virus E2 Glycoprotein Using Human Monoclonal Antibodies from Phage Display Libraries (2001) (52)
- Mini-FLOTAC and Kato-Katz: helminth eggs watching on the shore of lake Victoria (2013) (52)
- A Non-VH1-69 Heterosubtypic Neutralizing Human Monoclonal Antibody Protects Mice against H1N1 and H5N1 Viruses (2012) (51)
- Bacteriophages and Their Immunological Applications against Infectious Threats (2017) (51)
- Interferon-β-1a Inhibition of Severe Acute Respiratory Syndrome–Coronavirus 2 In Vitro When Administered After Virus Infection (2020) (50)
- Weak correlation between antibody titers and neutralizing activity in sera from SARS‐CoV‐2 infected subjects (2020) (48)
- Phage Display-based Strategies for Cloning and Optimization of Monoclonal Antibodies Directed against Human Pathogens (2012) (44)
- Nonneutralizing human antibody fragments against hepatitis C virus E2 glycoprotein modulate neutralization of binding activity of human recombinant Fabs. (2001) (43)
- Hepatitis C virus (HCV)-driven stimulation of subfamily-restricted natural IgM antibodies in mixed cryoglobulinemia. (2008) (41)
- A Novel Efflux System in Inducibly Erythromycin-Resistant Strains of Streptococcus pyogenes (2002) (41)
- Evaluation of resistance against bacterial microleakage of a new conical implant-abutment connection versus conventional connections: an in vitro study. (2016) (40)
- A closer look at prion strains (2013) (35)
- Cross-reactive pseudovirus-neutralizing anti-envelope antibodies coexist with antibodies devoid of such activity in persistent hepatitis C virus infection. (2004) (33)
- Perspectives for the utilization of neutralizing human monoclonal antibodies as anti-HCV drugs. (2008) (33)
- Diverging Effects of Human Recombinant Anti-Hepatitis C Virus (HCV) Antibody Fragments Derived from a Single Patient on the Infectivity of a Vesicular Stomatitis Virus/HCV Pseudotype (2002) (33)
- Enteric Microbiome Markers as Early Predictors of Clinical Outcome in Allogeneic Hematopoietic Stem Cell Transplant: Results of a Prospective Study in Adult Patients (2017) (32)
- Interferon-β 1a inhibits SARS-CoV-2 in vitro when administered after virus infection. (2020) (32)
- Molecular cloning of the first human monoclonal antibodies neutralizing with high potency swine-origin influenza A pandemic virus (S-OIV). (2009) (31)
- Antigen-Driven Evolution of B Lymphocytes in Coronary Atherosclerotic Plaques1 (2009) (30)
- Lessons from Italy’s policy shift on immunization (2018) (30)
- Characterization of epitopes recognized by monoclonal antibodies: experimental approaches supported by freely accessible bioinformatic tools. (2013) (29)
- Human monoclonal recombinant Fabs specific for HCV antigens obtained by repertoire cloning in phage display combinatorial vectors. (1997) (29)
- Anti-hepatitis C virus E2 (HCV/E2) glycoprotein monoclonal antibodies and neutralization interference. (2012) (29)
- Neutralization Interfering Antibodies: A “Novel” Example of Humoral Immune Dysfunction Facilitating Viral Escape? (2012) (29)
- In vitro phenotypes to elvitegravir and dolutegravir in primary macrophages and lymphocytes of clonal recombinant viral variants selected in patients failing raltegravir. (2013) (28)
- How Long Can Stool Samples Be Fixed for an Accurate Diagnosis of Soil-Transmitted Helminth Infection Using Mini-FLOTAC? (2015) (28)
- A phage display vector optimized for the generation of human antibody combinatorial libraries and the molecular cloning of monoclonal antibody fragments. (2012) (27)
- A Biologically-validated HCV E1E2 Heterodimer Structural Model (2017) (27)
- A vector for the expression of recombinant monoclonal Fab fragments in bacteria. (1998) (27)
- Molecular Diagnosis of Polymicrobial Sepsis (2009) (26)
- HCV E2 core structures and mAbs: something is still missing. (2014) (26)
- Inhibition of hepatitis C virus nonstructural protein, helicase activity, and viral replication by a recombinant human antibody clone. (2004) (26)
- Adaptive immunity against gut microbiota enhances apoE-mediated immune regulation and reduces atherosclerosis and western-diet-related inflammation (2016) (25)
- Anti-HIV-1 Response Elicited in Rabbits by Anti-Idiotype Monoclonal Antibodies Mimicking the CD4-Binding Site (2008) (25)
- Dynamic features of the selective pressure on the human immunodeficiency virus type 1 (HIV-1) gp120 CD4-binding site in a group of long term non progressor (LTNP) subjects (2009) (23)
- Assessing the human immune response to SARS-CoV-2 variants (2021) (22)
- Cross-Reacting Antibacterial Auto-Antibodies Are Produced within Coronary Atherosclerotic Plaques of Acute Coronary Syndrome Patients (2012) (22)
- Possible Future Monoclonal Antibody (mAb)-Based Therapy against Arbovirus Infections (2013) (21)
- Rapid molecular identification of fungal pathogens in corneal samples from suspected keratomycosis cases. (2006) (20)
- Global and local envelope protein dynamics of hepatitis C virus determine broad antibody sensitivity (2020) (19)
- Development and validation of a molecular method for the diagnosis of medically important fungal infections. (2007) (18)
- Direct sequencing of Scedosporium apiospermum DNA in the diagnosis of a case of keratitis. (2005) (18)
- Differential Composition of Vaginal Microbiome, but Not of Seminal Microbiome, Is Associated With Successful Intrauterine Insemination in Couples With Idiopathic Infertility: A Prospective Observational Study (2019) (18)
- HCV Proteins and Immunoglobulin Variable Gene (IgV) Subfamilies in HCV-Induced Type II Mixed Cryoglobulinemia: A Concurrent Pathogenetic Role (2012) (18)
- Pregnancy and H1N1 infection (2009) (18)
- Combined prophylactic and therapeutic use maximizes hydroxychloroquine anti-SARS-CoV-2 effects in vitro (2020) (18)
- Phage display for the production of human monoclonal antibodies against human pathogens. (2004) (17)
- Intracytoplasmic stable expression of IgG1 antibody targeting NS3 helicase inhibits replication of highly efficient hepatitis C Virus 2a clone (2010) (17)
- Has SARS-CoV-2 reached peak fitness? (2021) (17)
- Cell-to-Cell Spread Blocking Activity Is Extremely Limited in the Sera of Herpes Simplex Virus 1 (HSV-1)- and HSV-2-Infected Subjects (2019) (17)
- Natalizumab-associated progressive multifocal leukoencephalopathy. (2012) (17)
- Molecular Signatures of Hepatitis C Virus (HCV)-Induced Type II Mixed Cryoglobulinemia (MCII) (2012) (16)
- Production and Characterization of a Human Recombinant Monoclonal Fab Fragment Specific for Influenza A Viruses (2003) (15)
- Parasitic infections on the shore of Lake Victoria (East Africa) detected by Mini-FLOTAC and standard techniques. (2014) (14)
- Novel therapeutic investigational strategies to treat severe and disseminated HSV infections suggested by a deeper understanding of in vitro virus entry processes. (2016) (14)
- Humoral immune response against hepatitis C virus. (2003) (13)
- Cloning of the first human anti-JCPyV/VP1 neutralizing monoclonal antibody: epitope definition and implications in risk stratification of patients under natalizumab therapy. (2014) (13)
- Heterogeneity of the humoral anti-HCV/E2 response in persistently infected patients as demonstrated by divergent patterns of inhibition of the binding of anti-HCV/E2 human monoclonal antibodies. (2003) (12)
- Virus-induced preferential antibody gene-usage and its importance in humoral autoimmunity. (2015) (12)
- Use of recombinant human antibody fragments for detection of cytomegalovirus antigenemia (1997) (11)
- A new subtraction technique for molecular cloning of rare antiviral antibody specificities from phage display libraries. (1998) (11)
- Role and potential therapeutic use of antibodies against herpetic infections. (2017) (11)
- Influenza B-cells Protective Epitope Characterization: A Passkey for the Rational Design of New Broad-Range Anti-Influenza Vaccines (2012) (11)
- An improved phage display vector for antibody repertoire cloning by construction of combinatorial libraries. (1997) (11)
- Neutralization activity and kinetics of two broad-range human monoclonal IgG1 derived from recombinant Fab fragments and directed against Hepatitis C virus E2 glycoprotein. (2012) (11)
- Synergy evaluation of anti‐Herpes Simplex Virus type 1 and 2 compounds acting on different steps of virus life cycle (2018) (10)
- "Freezing" parasites in pre-Himalayan region, Himachal Pradesh: Experience with mini-FLOTAC. (2014) (10)
- Modulation of epitope‐specific anti‐hepatitis C virus E2 (anti‐HCV/E2) antibodies by anti‐viral treatment (2006) (9)
- Entry inhibition of HSV‐1 and ‐2 protects mice from viral lethal challenge (2017) (9)
- No evidence of helicobacter pylori sequences in pancreatic juices of patients affected by chronic pancreatitis (2000) (8)
- Potential role of the detection of enterobacterial DNA in blood for the management of neonatal necrotizing enterocolitis. (2012) (8)
- Cloning and characterization of human recombinant antibody Fab fragments specific for types 1 and 2 herpes simplex virus. (1995) (8)
- Cost-effectiveness of blood culture and a multiplex real-time PCR in hematological patients with suspected sepsis: an observational propensity score-matched study (2014) (8)
- Lessons from Italy's policy shift on immunization. (2018) (8)
- Major sports events and the transmission of SARS-CoV-2: analysis of seven case-studies in Europe (2020) (7)
- Epitope mapping by epitope excision, hydrogen/deuterium exchange, and peptide-panning techniques combined with in silico analysis. (2014) (7)
- A new plasmid cloning vector for direct detection of recombinant clones, based on inactivation of a bacterial acid phosphatase-encoding gene. (1995) (7)
- Adoptive T-cell therapy in the treatment of viral and opportunistic fungal infections. (2015) (7)
- Molecular profile of a human monoclonal antibody Fab fragment specific for Epstein-Barr virus gp350/220 antigen. (2001) (7)
- Microbiological diagnosis of sepsis: the confounding effects of a "gold standard". (2015) (6)
- Engineering human monoclonal antibody fragments: a recombinant enzyme-linked Fab. (1995) (6)
- Chimeric antigen receptor ( CAR )-engineered T cells redirected against hepatitis C virus ( HCV ) E 2 glycoprotein (2015) (6)
- Combined Prophylactic and Therapeutic Use Maximizes Hydroxychloroquine Anti-SARS-CoV-2 Effects in vitro (2020) (5)
- Risks of “Blind” Automated Identification Systems in Medical Microbiology (2013) (5)
- Lyme disease in Italy: Isolation of Borrelia burgdorferi from a patient (1988) (5)
- Expression of members of immunoglobulin gene family in somatic cell hybrids between human B and T cells. (1987) (5)
- Cloning and molecular characterization of a human recombinant IgG Fab binding to the Tat protein of human immunodeficiency virus type 1 (HIV-1) derived from the repertoire of a seronegative patient. (2006) (4)
- Is reduction of viral fitness a valid antiviral approach (2007) (4)
- Probing the natural antibody repertoire by combinatorial cloning of IgM and IgD isotypes in phage display vectors. (1998) (3)
- Quantitation of Bacillus clausii in biological samples by real-time polymerase chain reaction. (2006) (3)
- Detection of low-level HCV variants in DAA treated patients: comparison amongst three different NGS data analysis protocols (2020) (3)
- A novel expression vector for production of epitope-tagged recombinant Fab fragments in bacteria. (2001) (3)
- This information is current as in Coronary Atherosclerotic Plaques Antigen-Driven Evolution of B Lymphocytes Maseri and (2009) (2)
- Characterization and important implications (2013) (2)
- Divergent Trends of Anti-JCPyV Serum Reactivity and Neutralizing Activity in Multiple Sclerosis (MS) Patients during Treatment with Natalizumab (2016) (2)
- Rational Dosing Strategies of Colistin: What About Resistance? (2016) (2)
- Chimeric antigen receptor (CAR)-redirected T cells: is there a place for them in infectious diseases? (2015) (1)
- Molecular cloning and characterization of DNA from human intestinal spirochetes (1992) (1)
- Absence of hepatitis G virus infection in patients with alcoholic cirrhosis. (1997) (1)
- Heterosubtypic Protection Conferred by the Human Monoclonal Antibody PN-SIA28 against Influenza A Virus Lethal Infections in Mice (2015) (1)
- Early molecular diagnosis of aspergillosis in a patient with acute myeloid leukaemia (2014) (1)
- Erratum: Human monoclonal antibodies against a plethora of viral pathogens from single combinatorial libraries (Proceedings of the National Academy of Sciences of the United States of America (May 1, 1993) 90:9 (4141-4145)) (1994) (1)
- Human Monoclonal Antibodies as a New Class of Antiinfective Compounds (2013) (1)
- Mini-FLOTAC, Kato-Katz and McMaster: three methods, one goal; highlights from north Argentina (2014) (1)
- A Human Stem Cell-Derived Neurosensory–Epithelial Circuitry on a Chip to Model Herpes Simplex Virus Reactivation (2020) (1)
- [The effectiveness of the suspension of mandatory vaccinations in Veneto Region (Northern Italy) lacks scientific evidence]. (2019) (1)
- A recombinant human Fab inhibits helicase activity of HCV NS3 and negative strand RNA synthesis (2001) (1)
- Acute respiratory distress in a neutropenic febrile patient after hematopoietic cell transplantation. (2013) (1)
- Development of the Human Hybridoma Technology (1987) (0)
- SARS-CoV-2 before and after Omicron: two different viruses and two different diseases? (2023) (0)
- Epitope mapping of human antibody response against HCV/E2 glycoproteinby generation of monoclonal recombinant fabs (2000) (0)
- Production and characterization of a human recombinant monoclonal Fab fragment specifically directed to Influenza A viruses (2003) (0)
- A Biologically-validated HCV E1E2 Heterodimer Structural Model (2017) (0)
- Molecular study and epitope mapping of the human antibody response against HCV/E2 glycoprotein by generation of monoclonal recombinant Fabs (2000) (0)
- A human stem cell-derived neurosensory-epithelial circuitry ona-chip to model herpes 1 simplex virus reactivation 2 3 4 (2020) (0)
- Inhibition of HCV-NS3 helicase activity and negative strand rna syntesis by intracellular expression of a recombinant human anti-NS3 Fab (2001) (0)
- Preoperative Chemoradiotherapy for Esophageal Cancer (2012) (0)
- Structural basis for a human broadly neutralizing influenza A hemagglutinin stem-specific antibody including H17/18 subtypes (2022) (0)
- No evidence of helicobacter pylori sequences in the pancreatic juices of patients affected by alcoholic chronic pancreatitis (2000) (0)
- Virus E2 Protein Antibody Directed against the Hepatitis C and Neutralizing Human Monoclonal Identification of a Broadly Cross-Reacting (2013) (0)
- Broadly neutralizing anti-influenza human monoclonal antibodies and their possible role in predictive medicine (2013) (0)
- Molecular characterization of the human neutralizing response against hepatitis C virus and its role in the prediction of the infection outcome (2013) (0)
- Dissection of the anti-transglutaminase IgA1 local response by construction of phage-displayed combinatorial libraries from gastro-jejunal biopsies of patients with celiac disease (2000) (0)
- Detection of low-level HCV variants in DAA treated patients: comparison amongst three different NGS data analysis protocols (2020) (0)
- Answer to February 2019 Photo Quiz (2019) (0)
- monoclonal anti-hepatitis C as a medicament for the therapeutic treatment and prevention of infections by Hepatitis C virus (2009) (0)
- The Epstein-Barr Virus-Hybridoma Technique for Production of Human Monoclonal Antibodies (1988) (0)
- Characterization of four major human B-cell epitopes on the surface of HCV E2 glycoprotein by generation of human monoclonal fab from phage display antibody librariesis (2001) (0)
- Dissection of the IgA1 local response by construction of isotype-specific combinatorial libraries displayed on the surface of phage from gastrojejunal biopsies (2000) (0)
- Definition of biological activity and quantitation of different families of human anti-HCV/E2 antibodies by generation of human recombinant anti-E2 monoclonal Fab by phage display combinatorial repertoire library (2002) (0)
- Mini-FLOTAC and Kato-Katz: helminth eggs watching on the shore of lake Victoria (2013) (0)
- Blocking immunodominant epitopes by competitive deselection. (2002) (0)
- Molecular dissection of the human humoral response against HCV E2 glycoprotein by cloning of the antibody repertoire in phage display combinatorial vectors (2001) (0)
- LESGGGWQPGRSLRLSCAASGFTFR TYGMH WVRQAPGKGLEWVA VISYDGSKNYYADSVKG RFTISRDNSKKTLYLQMNSLRAEDTAVYYCAK DFWSGSTKNVFDL GLCHV 14 , LEQSGGGVVQPGRSLRLSCAASGFTFR TYGMH WVRQAPGKGLEWVA VISYDGSKNYYADSVKG RFTISRDNSKKTLYLQMNSLRAEDTAVYYCAK DFWSGSTKNVFDL GLCMV 12 LEQSGAELKRPWSSVKVSCKASGGTLR STAVN WVRQPPGQGLEWMGG LIPL (0)
- Photo Quiz: Neurological Symptoms in a 74-Year-Old Diabetic Woman Admitted to the Emergency Room (2019) (0)
- Antigen-Driven Evolution of B Lymphocytes (2009) (0)
This paper list is powered by the following services:
Other Resources About Roberto Burioni
What Schools Are Affiliated With Roberto Burioni?
Roberto Burioni is affiliated with the following schools:
