Shigeo Hirose
#26,218
Most Influential Person Now
Japanese academic
Shigeo Hirose's AcademicInfluence.com Rankings
Shigeo Hiroseengineering Degrees
Engineering
#530
World Rank
#889
Historical Rank
Mechanical Engineering
#79
World Rank
#100
Historical Rank
Applied Physics
#191
World Rank
#200
Historical Rank
Download Badge
Engineering
Shigeo Hirose's Degrees
- PhD Mechanical Engineering University of Tokyo
Why Is Shigeo Hirose Influential?
(Suggest an Edit or Addition)According to Wikipedia, Shigeo Hirose is a pioneer of robotics technology and a professor at the Tokyo Institute of Technology. Born in Tokyo and attending Hibiya High School, he graduated from Yokohama National University in 1971 and received a Ph.D. from Tokyo Institute of Technology in 1976 where he later took professorship.
Shigeo Hirose's Published Works
Number of citations in a given year to any of this author's works
Total number of citations to an author for the works they published in a given year. This highlights publication of the most important work(s) by the author
Published Works
- Biologically Inspired Robots: Snake-Like Locomotors and Manipulators (1993) (691)
- The Development of Soft Gripper for the Versatile Robot Hand (1978) (444)
- Shape memory alloy servo actuator system with electric resistance feedback and application for active endoscope (1988) (387)
- A Study of Design and Control of a Quadruped Walking Vehicle (1984) (383)
- MARCH‐V is a novel mitofusin 2‐ and Drp1‐binding protein able to change mitochondrial morphology (2006) (366)
- Molecular biology of major components of chloride cells. (2003) (284)
- Mechanism of acid adaptation of a fish living in a pH 3.5 lake. (2003) (260)
- Design and Control of a Mobile Robot with an Articulated Body (1990) (249)
- Snake-like robots [Tutorial] (2009) (231)
- Cloning and sequence analysis of cDNA for human renin precursor. (1983) (225)
- Ammonia secretion from fish gill depends on a set of Rh glycoproteins (2007) (183)
- Development of quadruped walking robot TITAN-VIII (1996) (174)
- Machine that can walk and climb on floors, walls and ceilings (1991) (168)
- Enhanced expression of endothelial oxidized low-density lipoprotein receptor (LOX-1) in hypertensive rats. (1997) (165)
- Biologically Inspired Robots (1993) (165)
- NURBS-based isogeometric analysis of buckling and free vibration problems for laminated composites plates with complicated cutouts using a new simple FSDT theory and level set method (2016) (162)
- On the high temperature mechanical behaviors analysis of heated functionally graded plates using FEM and a new third-order shear deformation plate theory (2016) (161)
- Expliner - Robot for inspection of transmission lines (2008) (157)
- Biologically Inspired Robots: Serpentile Locomotors and Manipulators (1993) (156)
- Walking and running of the quadruped wall-climbing robot (1994) (156)
- Regulation of mitochondrial morphology by USP30, a deubiquitinating enzyme present in the mitochondrial outer membrane. (2008) (153)
- Visualization in zebrafish larvae of Na(+) uptake in mitochondria-rich cells whose differentiation is dependent on foxi3a. (2007) (150)
- An Experimental Study of a Cooperative Positioning System (2000) (148)
- Biologically Inspired Snake-like Robots (2004) (147)
- Immunochemical identification of renin in rat brain and distinction from acid proteases (1978) (143)
- Normalized energy stability margin and its contour of walking vehicles on rough terrain (2001) (141)
- A simple FSDT-based isogeometric analysis for geometrically nonlinear analysis of functionally graded plates (2015) (140)
- Design of slim slime robot and its gait of locomotion (2001) (135)
- TITAN VII: quadruped walking and manipulating robot on a steep slope (1997) (135)
- Localization of ammonia transporter Rhcg1 in mitochondrion-rich cells of yolk sac, gill, and kidney of zebrafish and its ionic strength-dependent expression. (2007) (134)
- Identification of intestinal bicarbonate transporters involved in formation of carbonate precipitates to stimulate water absorption in marine teleost fish (2008) (133)
- Development of “Souryu‐IV” and “Souryu‐V:” Serially connected crawler vehicles for in‐rubble searching operations (2008) (129)
- Three-dimensional serpentine motion and lateral rolling by active cord mechanism ACM-R3 (2002) (125)
- Extended isogeometric analysis for dynamic fracture in multiphase piezoelectric/piezomagnetic composites (2016) (123)
- cGMP produced in response to ANP and CNP regulates proliferation and differentiation of osteoblastic cells. (1996) (120)
- Dimerization of Midkine by Tissue Transglutaminase and Its Functional Implication* (1997) (119)
- Characterization of osteoblastic differentiation of stromal cell line ST2 that is induced by ascorbic acid. (1999) (115)
- Study on Roller-Walker (multi-mode steering control and self-contained locomotion) (2000) (114)
- Genomic Organization and Regulation of Expression of the Lectin-like Oxidized Low-density Lipoprotein Receptor (LOX-1) Gene* (1998) (114)
- Design of in-pipe inspection vehicles for /spl phi/25, /spl phi/50, /spl phi/150 pipes (1999) (114)
- Design of In-Pipe Inspection Vehicles for ø25, ø50, ø150 Pi (1999) (110)
- Autocrine regulation of rat chondrocyte proliferation by natriuretic peptide C and its receptor, natriuretic peptide receptor-B. (1994) (110)
- Development of active cord mechanism ACM-R3 with agile 3D mobility (2001) (109)
- Snakes and Strings: New Robotic Components for Rescue Operations (2002) (108)
- A proposal for cooperative robot "Gunryu" composed of autonomous segments (1994) (108)
- Development of Genbu : Active wheel passive joint articulated mobile robot (2002) (107)
- Multiplicity, Structures, and Endocrine and Exocrine Natures of Eel Fucose-binding Lectins* (2000) (104)
- Deceleration by angiotensin II of the differentiation and bone formation of rat calvarial osteoblastic cells. (1998) (104)
- NHE3 in an ancestral vertebrate: primary sequence, distribution, localization, and function in gills. (2005) (101)
- Effects of nicotine on cultured cells suggest that it can influence the formation and resorption of bone. (1999) (100)
- Rh glycoprotein expression is modulated in pufferfish (Takifugu rubripes) during high environmental ammonia exposure (2010) (100)
- Study on cooperative positioning system: optimum moving strategies for CPS-III (1998) (100)
- Renin and prorenin in hog brain: Ubiquitous distribution and high concentration in the pituitary and pineal (1980) (98)
- Cloning and sequence analysis of a cDNA encoding human non-selective type of endothelin receptor. (1991) (98)
- Study on Roller-Walk (basic characteristics and its control) (1996) (94)
- 3-D local mesh refinement XFEM with variable-node hexahedron elements for extraction of stress intensity factors of straight and curved planar cracks (2017) (93)
- Takifugu obscurus is a euryhaline fugu species very close to Takifugu rubripes and suitable for studying osmoregulation (2005) (93)
- Coupled tendon-driven multijoint manipulator (1991) (92)
- Development of "Souryu I & II" -Connected Crawler Vehicle for Inspection of Narrow and Winding Space (2003) (92)
- The natriuretic peptide system in eels: a key endocrine system for euryhalinity? (2002) (91)
- Study on the 3D shape of active cord mechanism (2006) (91)
- Development of "Souryu-III": connected crawler vehicle for inspection inside narrow and winding spaces (2004) (91)
- Endothelin induces two types of contractions of rat uterus: phasic contractions by way of voltage-dependent calcium channels and developing contractions through a second type of calcium channels. (1989) (89)
- Generalized Standard Foot Trajectory for a Quadruped Walking Vehicle (1991) (89)
- Three-dimensional structure of human renin. (1985) (86)
- Buckling failure analysis of cracked functionally graded plates by a stabilized discrete shear gap extended 3-node triangular plate element (2015) (84)
- A passive weight compensation mechanism with a non-circular pulley and a spring (2010) (84)
- Development of Practical 3-Dimensional Active Cord Mechanism ACM-R4 (2006) (82)
- Buckling and vibration extended isogeometric analysis of imperfect graded Reissner-Mindlin plates with internal defects using NURBS and level sets (2016) (82)
- Purification and characterization of bovine lung endothelin receptor. (1991) (82)
- Coupled drive of the multi-DOF robot (1989) (81)
- Disk Rover: A Wall-climbing Robot Using Permanent (1992) (79)
- Titan III, A quadruped walking vehicle (1985) (79)
- An extended consecutive-interpolation quadrilateral element (XCQ4) applied to linear elastic fracture mechanics (2015) (79)
- MARCH-II is a syntaxin-6-binding protein involved in endosomal trafficking. (2005) (79)
- Study on Roller-Walker (system integration and basic experiments) (1999) (78)
- Angiotensin II stimulates the proliferation of osteoblast-rich populations of cells from rat calvariae. (1997) (78)
- Kinematic Control of Active Cord Mechanism with Tactile Sensors (1976) (78)
- Interfacial dynamic impermeable cracks analysis in dissimilar piezoelectric materials under coupled electromechanical loading with the extended finite element method (2015) (77)
- Development of the quadruped walking robot, TITAN-IX — mechanical design concept and application for the humanitarian de-mining robot (2001) (77)
- Expression of endocrine genes in zebrafish larvae in response to environmental salinity. (2007) (76)
- Mechanism of development of ionocytes rich in vacuolar-type H(+)-ATPase in the skin of zebrafish larvae. (2009) (76)
- Study on cooperative positioning system (basic principle and measurement experiment) (1996) (76)
- Structure, properties and enhanced expression of galactose-binding C-type lectins in mucous cells of gills from freshwater Japanese eels (Anguilla japonica). (2001) (76)
- Primary structure of the human elafin precursor preproelafin deduced from the nucleotide sequence of its gene and the presence of unique repetitive sequences in the prosegment. (1992) (75)
- The standard circular gait of a quadruped walking vehicle (1986) (75)
- Cleavage of Ig-Hepta at a “SEA” Module and at a Conserved G Protein-coupled Receptor Proteolytic Site* (2002) (73)
- Smoothing gradient damage model with evolving anisotropic nonlocal interactions tailored to low-order finite elements (2018) (72)
- Structure of the human renin gene. (1984) (72)
- Alveolar soft‐part sarcoma: A review on its histogenesis and further studies based on electron microscopy, immunohistochemistry, and biochemistry (1983) (71)
- In situ identification of messenger RNA of endothelial type nitric oxide synthase in rat cardiac myocytes. (1996) (70)
- Purification of atrial natriuretic peptide receptor from bovine lung. Evidence for a disulfide-linked subunit structure. (1987) (70)
- Development of Souryu-I connected crawler vehicle for inspection of narrow and winding space (2000) (70)
- Free fatty acids induce transglutaminase 2‐dependent apoptosis in hepatocytes via ER stress‐stimulated PERK pathways (2012) (68)
- Cloning and expression of eel natriuretic-peptide receptor B and comparison with its mammalian counterparts. (1994) (67)
- Eel urea transporter is localized to chloride cells and is salinity dependent. (2001) (67)
- Sky-Hook Suspension control of a quadruped walking vehicle (1994) (67)
- Development of optical six-axial force sensor and its signal calibration considering nonlinear interference (1990) (66)
- Quadruped walking robots at Tokyo Institute of Technology (2009) (66)
- A cutout isogeometric analysis for thin laminated composite plates using level sets (2015) (66)
- Nondestructive evaluation of damaged concrete using nonlinear ultrasonics (2009) (65)
- Ig-Hepta, a Novel Member of the G Protein-coupled Hepta-helical Receptor (GPCR) Family That Has Immunoglobulin-like Repeats in a Long N-terminal Extracellular Domain and Defines a New Subfamily of GPCRs* (1999) (64)
- Simultaneous characterization of quaternary alkaloids, 8-oxoprotoberberine alkaloids, and a steroid compound in Coscinium fenestratum by liquid chromatography hybrid ion trap time-of-flight mass spectrometry. (2009) (64)
- Dynamic and static fusion gait of a quadruped walking vehicle on a winding path (1992) (64)
- Tissue distribution and localization of natriuretic peptide receptor subtypes in stroke‐prone spontaneously hypertensive rats (1997) (63)
- The gait control system of a quadruped walking vehicle (1986) (63)
- Primary structure of bovine endothelin ETB receptor and identification of signal peptidase and metal proteinase cleavage sites. (1991) (63)
- Identification by Differential Display of a Hypertonicity-inducible Inward Rectifier Potassium Channel Highly Expressed in Chloride Cells* (1999) (63)
- Basic performance experiments for jumping quadruped (2003) (62)
- Development of a hyper-redundant multijoint manipulator for maintenance of nuclear reactors (1994) (62)
- Research on leg-wheel hybrid stair-climbing robot, Zero Carrier (2004) (62)
- MARCH-XI, a Novel Transmembrane Ubiquitin Ligase Implicated in Ubiquitin-dependent Protein Sorting in Developing Spermatids* (2007) (62)
- Design of terrain adaptive versatile crawler vehicle HELIOS-VI (2001) (61)
- Amphibious 3D active cord mechanism "HELIX" with helical swimming motion (2002) (60)
- Development of TITAN XI: a quadruped walking robot to work on slopes (2004) (60)
- Lung Surfactant Levels are Regulated by Ig-Hepta/GPR116 by Monitoring Surfactant Protein D (2013) (60)
- Native form of renin in the kidney. (1977) (60)
- Relationships between obesity and metabolic hormones in the "cobalt" variant of rainbow trout. (2002) (59)
- Tumble stability criterion of integrated locomotion and manipulation (1996) (59)
- Differential expression of Na+-Cl- cotransporter and Na+-K+-Cl- cotransporter 2 in the distal nephrons of euryhaline and seawater pufferfishes. (2011) (59)
- Design and experiments for a coupled tendon-driven manipulator (1993) (59)
- Partial cloning of the hormone-binding domain of the cortisol receptor in tilapia, Oreochromis mossambicus, and changes in the mRNA level during embryonic development. (1997) (58)
- Study on self-contained and terrain adaptive active cord mechanism (1999) (58)
- Feedforward and feedback dynamic trot gait control for a quadruped walking vehicle (2001) (58)
- Retinol-induced morphological changes of cultured bovine endothelial cells are accompanied by a marked increase in transglutaminase. (1989) (57)
- Mode-exciting method for Lamb wave-scattering analysis (2004) (56)
- Development of image stabilization system for remote operation of walking robots (2000) (55)
- Identification of plasma inactive renin as prorenin with a site-directed antibody. (1985) (55)
- Feedforward and Feedback Dynamic Trot Gait Control for Quadruped Walking Vehicle (2001) (55)
- Cloning and properties of a novel natriuretic peptide receptor, NPR-D. (1995) (54)
- Close Association of Carbonic Anhydrase (CA2a and CA15a), Na+/H+ Exchanger (Nhe3b), and Ammonia Transporter Rhcg1 in Zebrafish Ionocytes Responsible for Na+ Uptake (2013) (54)
- Development of Helios VII: an arm-equipped tracked vehicle for search and rescue operations (2004) (53)
- In vitro biosynthesis of human renin and identification of plasma inactive renin as an activation intermediate. (1985) (53)
- A snake-like robot for real-world inspection applications (the design and control of a practical active cord mechanism) (2013) (52)
- PipeTron series - Robots for pipe inspection (2014) (52)
- Stimulation by C-type natriuretic peptide of the differentiation of clonal osteoblastic MC3T3-E1 cells. (1996) (52)
- Molecular cloning of porcine soluble angiotensin-binding protein. (1992) (51)
- Mutational analysis of action of mitochondrial fusion factor mitofusin-2 (2005) (51)
- The TAQT Carrier: A Practical Terrain Adaptive Quadru-track Carrier Robot (1992) (50)
- Renin in rat and mouse brain: immunohistochemical identification and localization. (1980) (50)
- Bifunctional atrial natriuretic peptide receptor (type A) exists as a disulfide-linked tetramer in plasma membranes of bovine adrenal cortex. (1991) (50)
- Development of shape-memory alloy actuators. Performance assessment and introduction of a new composing approach (1988) (50)
- Effects of nitric oxide from exogenous nitric oxide donors on osteoblastic metabolism. (1998) (50)
- Differential subcellular distribution of neurolysin (EC 3.4.24.16) and thimet oligopeptidase (EC 3.4.24.15) in the rat brain (1999) (50)
- Immunochemical characterization and localization of endothelin ETB receptor. (1993) (50)
- Modulation by NaCl of atrial natriuretic peptide receptor levels and cyclic GMP responsiveness to atrial natriuretic peptide of cultured vascular endothelial cells. (1992) (49)
- Unique repetitive sequence and unexpected regulation of expression of rat endothelial receptor for oxidized low-density lipoprotein (LOX-1). (1998) (49)
- Machine Design of Biologically Inspired Robots (2009) (49)
- Development of quadruped walking robot with the mission of mine detection and removal-proposal of shape-feedback master-slave arm (1998) (49)
- Redundancy decomposition control for multi-joint manipulator (1989) (49)
- Study of Super-Mechano Colony: concept and basic experimental set-up (2001) (48)
- Roles of Slc13a1 and Slc26a1 sulfate transporters of eel kidney in sulfate homeostasis and osmoregulation in freshwater. (2005) (47)
- Coupled and decoupled actuation of robotic mechanisms (2000) (47)
- Regulation by 1α,25‐dihydroxyvitamin D3 of expression of stanniocalcin messages in the rat kidney and ovary (1999) (47)
- Analysis of 2-dimensional transient problems for linear elastic and piezoelectric structures using the consecutive-interpolation quadrilateral element (CQ4) (2016) (47)
- Cloning and sequence analysis of cDNA clones for bovine aortic-endothelial-cell transglutaminase. (1991) (47)
- Identification of renal transporters involved in sulfate excretion in marine teleost fish. (2009) (46)
- Study on quadruped walking robot in Tokyo Institute of Technology-past, present and future (2000) (46)
- Internally-balanced magnet unit (1986) (46)
- Characterization of osteoblastic differentiation of stromal cell line ST2 that is induced by ascorbic acid. (1999) (46)
- TITAN-XIII: sprawling-type quadruped robot with ability of fast and energy-efficient walking (2016) (46)
- Stage-specific enhanced expression of mitochondrial fusion and fission factors during spermatogenesis in rat testis. (2003) (46)
- Cloning, properties and tissue distribution of natriuretic peptide receptor-A of euryhaline eel, Anguilla japonica. (1999) (45)
- Float arm V: hyper-redundant manipulator with wire-driven weight-compensation mechanism (2003) (45)
- Targeting of Endopeptidase 24.16 to Different Subcellular Compartments by Alternative Promoter Usage* (1997) (45)
- Effect of initial stress on Love waves in a piezoelectric structure carrying a functionally graded material layer. (2010) (45)
- Active Cord Mechanism with Oblique Swivel Joints and Its Control (1981) (45)
- Study on three-dimensional active cord mechanism: development of ACM-R2 (2000) (45)
- Solubilization and molecular weight estimation of atrial natriuretic factor receptor from bovine adrenal cortex. (1985) (44)
- Improving local torque optimization techniques for redundant robotic mechanisms (1991) (44)
- Biomechanical Study on Serpentine Locomotion (1974) (44)
- Maneuvering operations of the quadruped walking robot on the slope (1996) (44)
- Study on slime robot (proposal of slime robot and design of slim slime robot) (2000) (43)
- Role of ascorbic acid in the osteoclast formation: induction of osteoclast differentiation factor with formation of the extracellular collagen matrix. (2000) (43)
- Nonlinear Ultrasonic Investigation of Concrete Damaged under Uniaxial Compression Step Loading (2010) (43)
- Dynamic stationary crack analysis of isotropic solids and anisotropic composites by enhanced local enriched consecutive-interpolation elements (2017) (43)
- Development of lightweight sprawling-type quadruped robot TITAN-XIII and its dynamic walking (2013) (43)
- Molecular and functional characterization of adrenomedullin receptors in pufferfish. (2006) (42)
- Intermittent trot gait of a quadruped walking machine dynamic stability control of an omnidirectional walk (1996) (42)
- Rough terrain locomotion of a leg-wheel hybrid quadruped robot (2006) (42)
- Locomotion of 3D Snake-Like Robots - Shifting and Rolling Control of Active Cord Mechanism ACM-R3 - (2006) (42)
- A novel type of urea transporter, UT-C, is highly expressed in proximal tubule of seawater eel kidney. (2005) (42)
- Reciprocal regulation by cyclic nucleotides of the differentiation of rat osteoblast-like cells and mineralization of nodules. (1995) (42)
- Accelerated Evolution in Inhibitor Domains of Porcine Elafin Family Members (*) (1996) (42)
- MARCH-III Is a novel component of endosomes with properties similar to those of MARCH-II. (2006) (41)
- Quasi-static crack propagation simulation by an enhanced nodal gradient finite element with different enrichments (2017) (41)
- Research on a six-legged walking robot with parallel mechanism (1998) (41)
- Development of snake-like robot ACM-R8 with large and mono-tread wheel (2015) (40)
- Loop forming snake-like robot ACM-R7 and its Serpenoid Oval control (2010) (40)
- Study on slime robot: development of the mobile robot prototype model using bridle bellows (2004) (40)
- SMC rover: planetary rover with transformable wheels (2002) (40)
- Development of a light weight torque limiting M-Drive actuator for hyper-redundant manipulator Float Arm (1999) (40)
- Cloning, properties, site-directed mutagenesis analysis of the subunit structure, tissue distribution and regulation of expression of the type-C eel natriuretic peptide receptor. (1995) (40)
- Isogeometric analysis for unsaturated flow problems (2014) (40)
- Elastodynamic inversion for shape reconstruction and type classification of flaws (2002) (39)
- Roles of heme oxygenase/carbon monoxide system in genetically hypertensive rats. (1997) (39)
- Brain renin from bovine anterior pituitary. Isolation and properties. (1982) (39)
- Gunryu III: reconfigurable magnetic wall-climbing robot for decommissioning of nuclear reactor (2013) (39)
- Study of Active Cord Mechanism (2008) (39)
- Development of a Cleaning Robot System with Cooperative Positioning System (2000) (39)
- SIFs evaluation of sharp V-notched fracture by XFEM and strain energy approach (2017) (38)
- An extracellular transglutaminase is required for apple pollen tube growth. (2010) (38)
- Nitric oxide accelerates the ascorbic acid-induced osteoblastic differentiation of mouse stromal ST2 cells by stimulating the production of prostaglandin E(2). (2000) (38)
- A stabilized discrete shear gap extended finite element for the analysis of cracked Reissner–Mindlin plate vibration problems involving distorted meshes (2016) (38)
- Development of mobile robots for rescue operations (2002) (38)
- HELIOS system: A team of tracked robots for special urban search and rescue operations (2009) (38)
- Development of a coupled tendon-driven 3D multi-joint manipulator (2014) (37)
- Down-regulation of atrial natriuretic peptide receptor and cyclic GMP response in cultured rat vascular smooth muscle cells. (1987) (37)
- A New Design Method of Servo-actuators Based on the Shape Memory Effect (1985) (37)
- Specific Antibody to Hog Renal Renin and Its Application to the Direct Radioimmunoassay of Renin in Various Organs (1979) (37)
- Fundamental considerations for the design of a planetary rover (1995) (36)
- Enhanced expression and release of C-type natriuretic peptide in freshwater eels. (2001) (36)
- Quadruped Walking Robot Centered Demining System - Development of TITAN-IX and its Operation- (2005) (36)
- 3-D elasto-plastic large deformations: IGA simulation by Bézier extraction of NURBS (2017) (36)
- HELIOS IX tracked vehicle for urban search and rescue operations: Mechanical design and first tests (2008) (36)
- Development of leg-wheel hybrid quadruped “AirHopper” design of powerful light-weight leg with wheel (2008) (36)
- Holonomic omnidirectional vehicle with new omni-wheel mechanism (2001) (36)
- Cloning, amino acid sequence and tissue distribution of porcine thimet oligopeptidase. A comparison with soluble angiotensin-binding protein. (1994) (35)
- Mutational analysis of disulfide bridges in the type C atrial natriuretic peptide receptor. (1994) (35)
- Identification of Zebrafish Fxyd11a Protein that is Highly Expressed in Ion-Transporting Epithelium of the Gill and Skin and its Possible Role in Ion Homeostasis (2010) (35)
- Transient dynamic analysis of interface cracks in layered anisotropic solids under impact loading (2009) (35)
- An improved method for determination of active and total renin concentration in human plasma using an excess of sheep substrate. (1984) (35)
- Sequential determination of glutamate-oxalacetate transaminase and glutamate-pyruvate transaminase activities in serum using an immobilized bienzyme-poly(vinyl chloride) membrane electrode. (1984) (35)
- New fluorogenic substrates for renin. (1981) (35)
- Stabilization of the head of an undulating snake-like robot (2007) (34)
- Fundamental performance of a 6 wheeled off-road vehicle "HELIOS-V" (1999) (34)
- Endothelins inhibit the mineralization of osteoblastic MC3T3-E1 cells through the A-type endothelin receptor. (1998) (34)
- Comparative molecular biology of natriuretic peptide receptors. (2001) (34)
- Snake-like active wheel robot ACM-R4.1 with joint torque sensor and limiter (2011) (33)
- Reflection of Obliquely Incident Guided Waves by an Edge of a Plate (2007) (33)
- Boundary element analysis of guided waves in a bar with an arbitrary cross-section (2005) (33)
- Expliner - Toward a Practical Robot for Inspection of High-Voltage Lines (2009) (33)
- Role of natriuretic peptide receptor type C in Dahl salt-sensitive hypertensive rats. (1997) (32)
- Zebrafish early cardiac connexin, Cx36.7/Ecx, regulates myofibril orientation and heart morphogenesis by establishing Nkx2.5 expression (2008) (32)
- Tensor Actuated Elastic Manipulator (1983) (32)
- Membrane-associated RING-CH 10 (MARCH10 Protein) Is a Microtubule-associated E3 Ubiquitin Ligase of the Spermatid Flagella* (2011) (32)
- Numerical analysis of 3-D solids and composite structures by an enhanced 8-node hexahedral element (2017) (32)
- Development of Active-Joint Active-Wheel High Traversability Snake-Like Robot ACM-R4.2 (2013) (32)
- Application of the boundary integral equation (BIE) method to transient response analysis of inclusions in a half space (1986) (31)
- Design and Development of Active Cord Mechanism “ACM-R3” and its 3-dimensional Locomotion Control (2005) (31)
- Purification and characterization of angiotensin-binding protein from porcine liver cytosolic fraction. (1989) (31)
- The whisker sensor and the transmission of multiple sensor signals (1989) (31)
- Study on Roller-Walker - Energy efficiency of Roller-Walk - (2011) (31)
- Development of multi-wheeled snake-like rescue robots with active elastic trunk (2012) (30)
- Helios VII: a new vehicle for disaster response — mechanical design and basic experiments (2005) (30)
- Design of a quadruped walking vehicle for dynamic walking and stair climbing (1994) (30)
- Development of walking manipulator with versatile locomotion (2003) (30)
- Study on Roller-Walker - Adaptation of characteristics of the propulsion by a leg trajectory - (2008) (30)
- Design and Control of 6-DOF Mechanism for Twin-Frame Mobile Robot (2001) (30)
- Natriuretic Peptides and Their Receptors (1995) (30)
- Development of a quadruped walking robot to work on steep slopes, TITAN XI (walking motion with compensation for compliance) (2005) (30)
- A Study on the Mechanism and Locomotion Strategy for New Snake-Like Robot Active Cord Mechanism - Slime model 1 ACM-S1 (2008) (30)
- Development of tethered autonomous mobile robot systems for field works (2001) (30)
- Concentration of mRNA for the natriuretic peptide receptor-C in hypertrophic chondrocytes of the fetal mouse tibia. (2000) (30)
- Development of Arm Equipped Single Wheel Rover: Effective Arm-Posture-Based Steering Method (2003) (30)
- Euryhaline pufferfish NBCe1 differs from nonmarine species NBCe1 physiology. (2012) (29)
- Definitive evidence for renin in rat brain by affinity chromatographic separation from protease. (1978) (29)
- Operation of underwater rescue robot anchor diver III during the 2011 Tohoku Earthquake and Tsunami (2011) (29)
- Dynamic And Static Fusion Control Of Quadruped Walking Vehicle (1989) (29)
- Rhesus Glycoprotein P2 (Rhp2) Is a Novel Member of the Rh Family of Ammonia Transporters Highly Expressed in Shark Kidney* (2009) (29)
- Development of a Quadruped Walking Robot TITAN XI for Steep Slope Operation - Step Over Gait to Avoid Concrete Frames on Steep Slopes - (2007) (29)
- INTERMEDIATE MOLECULAR WEIGHT RENIN AND RENIN-BINDING PROTEIN(S) IN THE HOG KIDNEY (1980) (29)
- Basic steering control methods for the articulated body mobile robot (1994) (29)
- Development of Quadruped Walking Robot TITAN-VIII for Commercially Available Research Platform (1999) (28)
- Development of a shape memory alloy actuator. Improvement of output performance by the introduction of a sigma-mechanism (1988) (28)
- Localization and characterization of a novel receptor for endothelin in the gills of the rainbow trout. (1995) (28)
- CT ARM-I: coupled tendon-driven manipulator model I-design and basic experiments (1992) (28)
- A new flexible component for field robotic system (2000) (28)
- Teleoperated Buggy Vehicle and Weight Balanced Arm for Mechanization of Mine Detection and Clearance Tasks (2005) (28)
- Super Mechano-System: New Perspective for Versatile Robotic System (2000) (28)
- Development of "Souryu-III" : Connected crawler vehicle for inspection of narrow and winding space (2003) (28)
- Complementary DNA sequences of renin. State-of-the-art review. (1984) (28)
- Effects of Desacetyl-α-MSH on Lipid Mobilization in the Rainbow Trout, Oncorhynchus mykiss (2000) (27)
- Design of Slim Slime Robot II (SSR-II) with Bridle Bellows (2002) (27)
- SkyScraper-I: Tethered whole windows cleaning robot (2010) (27)
- An in-pipe robot with underactuated parallelogram crawler modules (2014) (27)
- Sensory systems and ionocytes are targets for silver nanoparticle effects in fish (2016) (27)
- A 2D time-domain BEM for transient wave scattering analysis by a crack in anisotropic solids (2005) (27)
- Internally Balanced Magnetic Unit (1985) (27)
- Angiotensin II-dependent down-regulation of vascular natriuretic peptide type C receptor gene expression in hypertensive rats. (1996) (27)
- Subtype switching of natriuretic peptide receptors in rat chondrocytes during in vitro culture. (1994) (26)
- Preparation and structures of the poly(vinyl chloride) porous membranes (1979) (26)
- Ubiquitin-specific protease 19 regulates the stability of the E3 ubiquitin ligase MARCH6. (2014) (26)
- Na+/H+ and Na+/NH+4 activities of zebrafish NHE3b expressed in Xenopus oocytes. (2014) (26)
- Design of Steerable Endoscopes to Improve the Visual Perception of Depth During Laparoscopic Surgery (2004) (26)
- Development of the quadruped walking robot, "TITAN-IX" (2000) (26)
- Structure of the bovine atrial natriuretic peptide receptor (type C) gene. (1991) (26)
- Isolation and determination of the amino acid sequence of chicken calcitonin I from chicken ultimobranchial glands. (1986) (26)
- Static Stability Criterion for Walking Robots on Irregular Terrains (1998) (26)
- Interrelation between nitric oxide synthase and heme oxygenase in rat endothelial cells. (1997) (26)
- Endpoint Vibration Control of a Mobile Mine-Detecting Robotic Manipulator (2007) (26)
- Development of track-changeable quadruped walking robot TITAN X-design of leg driving mechanism and basic experiment- (2010) (26)
- Totally inactive renin zymogen and different forms of active renin in hog brain tissues. (1981) (26)
- Mutations in Fibroblast Growth Factor Receptor 2 Gene and Craniosynostotic Syndromes in Japanese Children (1998) (26)
- Study of a 2-DOF joint for the small Active Cord Mechanism (2009) (25)
- Humanitarian Demining Robot Gryphon – Current Status And An Objective Evaluation – (2008) (25)
- High frequency modes meshfree analysis of Reissner–Mindlin plates (2016) (25)
- Development of Shape Memory Alloy Actuator (1987) (25)
- Image-based sizing of surface-breaking cracks by SH-wave array ultrasonic testing. (2006) (25)
- The Synthesis of Basic Motion Regulator System for Quadrupedal Walking Vehicle and Its Experiments (1980) (25)
- Bleustein–Gulyaev waves in 6 mm piezoelectric materials loaded with a viscous liquid layer of finite thickness (2010) (25)
- Control of a multijoint manipulator "Moray arm" (2002) (25)
- Development of Pneumatically Controlled Expandable Arm for Search in the Environment with Tight Access (2003) (25)
- Immunohistochemical localization of atrial natriuretic peptide receptor in bovine kidney and lung. (1989) (25)
- Multiple processing of Ig-Hepta/GPR116, a G protein-coupled receptor with immunoglobulin (Ig)-like repeats, and generation of EGF2-like fragment. (2006) (25)
- Localization of porcine trappin-2 (SKALP/elafin) in trachea and large intestine by in situ hybridization and immunohistochemistry (2000) (24)
- Determination of glutamate-pyruvate transaminase activity in blood serum with a pyruvate oxidase/poly(vinyl chloride) membrane sensor (1984) (24)
- Study of walking robot for 3 dimensional terrain (1995) (24)
- Zero Carrier: A Novel Eight Leg-Wheels Hybrid Stair Climbing Mobile Vehicle (2005) (24)
- 3 axial force sensor for a semi-autonomous snake robot (2009) (24)
- DNA superhelicity affects the formation of transcription preinitiation complex on eukaryotic genes differently. (1991) (24)
- Robotic system for humanitarian demining (2004) (24)
- FHL5, a novel actin-binding protein, is highly expressed in eel gill pillar cells and responds to wall tension. (2004) (24)
- A New Approach to Humanitarian Demining (2005) (24)
- Development of a shape memory alloy actuator. Measurement of material characteristics and development of active endoscopes (1989) (23)
- Bias-tolerant terrain following method for a field deployed manipulator (2006) (23)
- Development of Terrain Adaptive Quadru-Track Vehicle HELIOS-II (1992) (23)
- Snake, walking and group robots for super mechano-system (1999) (23)
- Convolution quadrature time-domain boundary element method for 2-D and 3-D elastodynamic analyses in general anisotropic elastic solids (2014) (23)
- Development of X-screw: a load-sensitive actuator incorporating a variable transmission (1999) (23)
- Crouzon syndrome with acanthosis nigricans: case report and mutational analysis. (2000) (23)
- Development of an actuation system based on water jet propulsion for a slim long-reach robot (2017) (22)
- Physical and functional association of the atrial natriuretic peptide receptor with particulate guanylate cyclase as demonstrated using detergent extracts of bovine lung membranes. (1986) (22)
- Vascular action of circulating and local natriuretic peptide systems is potentiated in obese/hyperglycemic and hypertensive rats. (1996) (22)
- Expression of the K+ channel Kir7.1 in the developing rat kidney: role in K+ excretion. (2003) (22)
- Wall Climbing Vehicle Using Internally Balanced Magnetic Unit (1987) (22)
- Fundamental mechanism of dinosaur-like robot TITRUS-II utilizing coupled drive (2000) (22)
- Robotics-assisted demining with Gryphon (2007) (22)
- A variant form of the type C atrial natriuretic peptide receptor generated by alternative RNA splicing. (1993) (22)
- Inhibition of proliferation of chondrocytes by specific receptors in response to retinoids. (1996) (22)
- HIGH-AFFINITY ANGIOTENSIN II RECEPTORS IN THE BOVINE OVARY ARE DIFFERENT FROM THOSE PREVIOUSLY IDENTIFIED IN OTHER TISSUES (1988) (22)
- HELIOS VIII search and rescue robot: Design of an adaptive gripper and system improvements (2007) (21)
- Fish calcitonin receptor has novel features. (2007) (21)
- Biochemical and immunohistochemical localization of renin in human pituitary. (1984) (21)
- Headless splice variant acting as dominant negative calcitonin receptor. (2007) (21)
- A global localization approach based on Line-segment Relation Matching technique (2012) (21)
- Toward Development of Practical Quadruped Walking Vehicles (1993) (21)
- His145-Trp146 residues and the disulfide-linked loops in atrial natriuretic peptide receptor are critical for the ligand-binding activity. (1994) (21)
- Wet poly(vinyl chloride) membrane (1981) (21)
- Artificial neural network model using ultrasonic test results to predict compressive stress in concrete (2017) (21)
- High-density localization of ANP receptors in chondrocytes of eel gill cartilage. (1993) (21)
- Induction of Cross-Linking and Silencing of Sp1 by Transglutaminase during Liver Injury in ASH and NASH via Different ER Stress Pathways (2011) (21)
- Proposal for automation of humanitarian demining with buggy robots (2003) (21)
- Identification and proximal tubular localization of the Mg²⁺ transporter, Slc41a1, in a seawater fish. (2013) (21)
- A thin-film piezoelectric impact sensor array fabricated on a Si slider for measuring head-disk interaction (1995) (21)
- MOLECULAR CLONING OF DNA COMPLEMENTARY TO MOUSE SUBMANDIBULAR GLAND RENIN mRNA (1982) (21)
- A Simple Assay and Histochemical Localization of Transglutaminase Activity Using a Derivative of Green Fluorescent Protein as Substrate (2001) (21)
- Development of a Transformable Three‐wheeled Lunar Rover: Tri‐Star IV (2014) (21)
- A 56,000-dalton renin-binding protein in hog kidney is an endogenous renin inhibitor. (1981) (21)
- Mechanical design of three-wheeled lunar rover; “Tri-Star IV” (2011) (20)
- The proposal of swarm type wall climbing robot system "Anchor Climber" $the design and examination of adhering mobile unit $ (2005) (20)
- A Weight Compensation Mechanism with a Non-Circular Pulley and a Spring: Application to a Parallel Four-Bar Linkage Arm (2010) (20)
- Development of Hi-Grip Crawler using a Deformation of Powder (1997) (20)
- Gene expression of endothelial type isoform of nitric oxide synthase in various tissues of stroke-prone spontaneously hypertensive rats. (1997) (20)
- Numerical studies of an array of equidistant semi-permeable inclined cracks in 2-D piezoelectric strip using distributed dislocation method (2016) (20)
- Dynamic redundancy resolution of redundant manipulators with local optimization of a kinematic criterion (1995) (20)
- Design of SMC rover: development and basic experiments of arm equipped single wheel rover (2001) (20)
- Inverse Problem for Shape Reconstruction of Plate-Thinning by Guided SH-Waves (2012) (20)
- Study on Roller-Walker (2000) (20)
- Human renin gene of renin-secreting tumor. (1986) (20)
- Basic manipulation considerations for the articulated body mobile robot (1998) (20)
- Identification of SAMT family proteins as substrates of MARCH11 in mouse spermatids (2011) (20)
- Three-legged walking for fault tolerant locomotion of a quadruped robot with demining mission (2000) (20)
- Molecular cloning and characteristics of a novel zinc finger protein and its splice variant whose transcripts are expressed during spermatogenesis. (2003) (20)
- Study on Roller-Walker — Improvement of Locomotive Efficiency of Quadruped Robots by Passive Wheels (2012) (20)
- Basic systematic experiments and new type child unit of Anchor Climber: Swarm type wall climbing robot system (2008) (20)
- MARCH7 E3 ubiquitin ligase is highly expressed in developing spermatids of rats and its possible involvement in head and tail formation (2013) (20)
- Synthesis and characterization of human prorenin in Escherichia coli. (1986) (19)
- The transcript for a novel protein with a zinc finger motif is expressed at specific stages of mouse spermatogenesis. (2000) (19)
- Perichondrial localization of ETA receptor in rat tracheal and xiphoid cartilage and in fetal rat epiphysis. (1995) (19)
- RENIN PRECURSOR IN HOG KIDNEY. OCCURRENCE AND PARTIAL CHARACTERIZATION (1980) (19)
- Development of Quadruped Walking Robot TITAN XI for Steep Slopes - Slope Map Generation and Map Information Application - (2006) (19)
- Maneuvering operations of a quadruped walking robot on a slope (1996) (19)
- Dispersion characteristics of transverse surface waves in piezoelectric coupled solid media with hard metal interlayer. (2011) (19)
- Design of Large Motion Range and Heavy Duty 2-DOF Spherical Parallel Wrist Mechanism (2013) (18)
- Elafin expression in human fetal and adult submandibular glands (2002) (18)
- Study on Cooperative Positioning System (1996) (18)
- HELIOS carrier: Tail-like mechanism and control algorithm for stable motion in unknown environments (2009) (18)
- Development of Shape Memory Alloy Actuator (Performance evaluation and introduction of a new design concept) (1986) (18)
- Three-Dimensional Stability Criterion of Integrated Locomotion and Manipulation (1997) (18)
- A time-domain collocation-Galerkin BEM for transient dynamic crack analysis in anisotropic solids (2005) (18)
- Mechanical design of walking machines (2007) (18)
- Expression of a novel isoform of Na(+)/H(+) exchanger 3 in the kidney and intestine of banded houndshark, Triakis scyllium. (2013) (18)
- Modulation of vascular natriuretic peptide receptor gene expression in hypertensive and obese hyperglycemic rats. (1995) (18)
- Fucosterol decreases angiotensin converting enzyme levels with reduction of glucocorticoid receptors in endothelial cells. (1986) (18)
- Inhibition of atrial natriuretic peptide-induced cyclic GMP accumulation in the bovine endothelial cells with anti-atrial natriuretic peptide receptor antiserum. (1989) (17)
- High molecular weight renin in stroke-prone spontaneously hypertensive rats. (1980) (17)
- A Novel Potential Role for Gametogenetin-Binding Protein 1 (GGNBP1) in Mitochondrial Morphogenesis During Spermatogenesis in Mice1 (2009) (17)
- The Proposal of the Intermittent Crawl Gait and its Generation (1999) (17)
- Toward Development of Practical Quadruped Walking Vehicle (1993) (17)
- Approximations to continuous curves of Active Cord Mechanism made of arc-shaped joints or double joints (2010) (17)
- Three-legged walking for fault-tolerant locomotion of demining quadruped robots (2002) (17)
- Monitoring Damage Using Acoustic Emission Source Location and Computational Geometry in Reinforced Concrete Beams (2018) (17)
- Angiotensinogen-producing hepatocellular carcinoma. (1984) (17)
- Correlation between induction of expression of biglycan and mineralization by C-type natriuretic peptide in osteoblastic cells. (1999) (17)
- Dispersion of ultrasonic surface waves in a steel–epoxy–concrete bonding layered medium based on analytical, experimental, and numerical study (2014) (17)
- Loss of the adhesion G-protein coupled receptor ADGRF5 in mice induces airway inflammation and the expression of CCL2 in lung endothelial cells (2019) (17)
- Steering of pedal wave of a snake-like robot by superposition of curvatures (2010) (17)
- Morphological and functional characterization of a novel Na+/K+-ATPase-immunoreactive, follicle-like structure on the gill septum of Japanese banded houndshark, Triakis scyllium (2012) (16)
- Tumble Stability Criterion of a Walking Machine (1996) (16)
- Properties and localization of endothelin-1-specific receptors in rat testicles. (1992) (16)
- Study of super-mechano-colony (concept and basic experimental setup) (2000) (16)
- Subtype switching of ANP receptors during in vitro culture of vascular cells. (1989) (16)
- A new sensitive direct radioimmunoassay for human plasma renin and its clinical application. (1984) (16)
- Vasoactive peptide-regulated gene expression during osteoblastic differentiation. (2000) (16)
- Polyvinylhcloride membrane for a glucose sensor (1979) (16)
- Quadruped Walking Robot with Reduced Degrees of Freedom (2001) (16)
- Stuck evasion control for active-wheel passive-joint snake-like mobile robot 'genbu' (2004) (16)
- Mechanical Design of Mobile Robot for External Environments (2000) (16)
- Targeted Disruption of Ig-Hepta/Gpr116 Causes Emphysema-like Symptoms That Are Associated with Alveolar Macrophage Activation* (2015) (16)
- CHARACTERIZATION OF ATRIAL NATRIURETIC FACTOR RECEPTORS IN ADRENAL CORTEX, VASCULAR SMOOTH MUSCLE AND ENDOTHELIAL CELLS BY AFFINITY LABELING (1986) (16)
- Laser triangulation range finder available under direct sunlight (1988) (16)
- Development of Holonomic Omnidirectional Vehicle "Vuton-II" with Omni-Discs (2002) (16)
- Study on ankle mechanism for walking robots: development of 2 d.o.f. coupled drive ankle mechanism with wide motion range (2004) (16)
- Development of Mine Hands: Extended Prodder for Protected Demining Operation (2005) (15)
- Piezoelectric Love Waves in an FGPM Layered Structure (2011) (15)
- Image Based EFIT Simulation for Nondestructive Ultrasonic Testing of Austenitic Steel (2009) (15)
- Steep slope locomotion and manipulation mechanism with minimum degrees of freedom (1999) (15)
- Androgen-Dependent Expression, Gene Structure, and Molecular Evolution of Guinea Pig Caltrin II, a WAP-Motif Protein1 (2004) (15)
- Real-time stereo vision with multiple arrayed camera (1992) (15)
- Study on a practical robotic follower to support home oxygen therapy patients-development and control of a mobile platform (2011) (15)
- HELIOS VIII: Toward Practical Robots for Search and Rescue Operations (2008) (15)
- Cloning, Characterization, and Tissue Distribution of Porcine SPAI, a Protein with a Transglutaminase Substrate Domain and the WAP Motif (*) (1995) (15)
- The efficacy of the neck and tail of miniature dinosaur-like robot TITRUS-III (2002) (15)
- Study of Active Cord Mechanism-Generalized Basic Equations of the Locomotive Dynamics of the ACM and Analysis of Sinus-lifting- (2008) (15)
- Role of C‐terminus of Kir7.1 potassium channel in cell‐surface expression (2006) (15)
- Three-dimensional numerical modeling of ultrasonic wave propagation in concrete and its experimental validation (2015) (15)
- A novel purification method of human renin. (1983) (15)
- Development of VmaxCarrier2: omni-directional mobile robot with function of step-climbing (2004) (15)
- Variable Constraint Mechanism and Its Application for Design of Mobile Robots (2000) (15)
- The standing posture transformation gait of a quadruped walking vehicle (1987) (15)
- A New Approach to Humanitarian Demining (2005) (15)
- Transient elastic wave analysis of 3-D large-scale cavities by fast multipole BEM using implicit Runge–Kutta convolution quadrature (2016) (14)
- Creative Education at Tokyo Institute of Technology (1998) (14)
- Shape Reconstruction of Plate Thinning Using Reflection Coefficients of Ultrasonic Lamb Waves : a Numerical Approach (2012) (14)
- Possible role of DNA topoisomerase II on transcription of the homeobox gene Hox-2.1 in F9 embryonal carcinoma cells. (1991) (14)
- Endothelium localization of ETB receptor revealed by immunohistochemistry. (1993) (14)
- Identification of a Novel Osteoblastic Gene, Inducible by C-type Natriuretic Peptide, Whose Transcript Might Function in Mineralization as a Noncoding RNA (2002) (14)
- Identification and lateral membrane localization of cyclin M3, likely to be involved in renal Mg2+ handling in seawater fish. (2014) (14)
- Immunochemical and biochemical distinction of subtypes of atrial natriuretic peptide receptor. (1989) (14)
- Identification of G protein-coupled endothelin receptors in cultured bovine endothelial cells. (1991) (14)
- Structure of the bovine ETB endothelin receptor gene. (1992) (14)
- Development of a stable localized visual inspection system for underwater structures (2016) (14)
- Intermittent Trot Gait of a Quadruped walking Machine (1996) (14)
- Coupling of numerical Green's matrix and boundary integral equations for the elastodynamic analysis of inhomogeneous bodies on an elastic half-space (1984) (14)
- Spliced isoforms of LIM‐domain‐binding protein (CLIM/NLI/Ldb) lacking LIM interaction domain (2006) (14)
- Vibration analysis of rubber vibration isolators of vehicle using the restoring force model of power function type : (Analysis of nonlinear vibration using frequency characteristics determined by the hysteresis loop) (1995) (14)
- O2-Filled Swimbladder Employs Monocarboxylate Transporters for the Generation of O2 by Lactate-Induced Root Effect Hemoglobin (2012) (14)
- Propagation of thickness-twist waves in a piezoelectric ceramic plate in contact with viscous fluids (2010) (13)
- Secondary DNA structure formation for Hoxb9 promoter and identification of its specific binding protein (2008) (13)
- Effect of Load Pattern in the Generation of Higher Harmonic Amplitude in Concrete Using Nonlinear Ultrasonic Test (2016) (13)
- Articulated Body Mobile Robot (1989) (13)
- Inverse Shape Reconstruction of Inner Cavities Using Guided SH-Waves in a Plate (2015) (13)
- Stimulation by retinoids of the natriuretic peptide system of osteoblastic MC3T3-E1 cells. (1996) (13)
- Distribution of Stanniocalcin 1 in Rat Kidney and Its Regulation by Vitamin D3 (2001) (13)
- Identification and properties of a novel variant of NBC4 (Na(+)/HCO(3)- co-transporter 4) that is predominantly expressed in the choroid plexus. (2013) (13)
- Development of the Crown Motor (2001) (13)
- Machine That Can Walk and Climb on Floors, Walls and Ceilings. (1991) (13)
- Theoretical validation on the existence of two transverse surface waves in piezoelectric/elastic layered structures. (2012) (13)
- FRP-confined concrete model based on damage-plasticity and phase-field approaches (2020) (13)
- Interface waves in functionally graded piezoelectric materials (2010) (13)
- Orphan GPR116 mediates the insulin sensitizing effects of the hepatokine FNDC4 in adipose tissue (2021) (13)
- Autonomous control of an engine-driven mobile platform for field robotic systems (2001) (13)
- Convolution Quadrature Time-domain Boundary Element Method and Acceleration by the Fast Multipole Method in 2-D Viscoelastic Wave Propagation (2009) (13)
- RING finger, B-box, and coiled-coil (RBCC) protein expression in branchial epithelial cells of Japanese eel, Anguilla japonica. (2002) (13)
- Convolution quadrature time-domain boundary element method for 2-D fluid-saturated porous media (2014) (13)
- A walking and wheeled hybrid locomotion with twin-frame structure robot (2002) (13)
- Dynamic & Static Fusion Control and Continuous Trajectory Generation of Quadruped Walking Vehicle (1991) (13)
- The Basic Considerations on Energetic Efficiencies of Walking Vehicle (1979) (13)
- Determination of urea in blood serum with use of immobilized urease and a microwave cavity ammonia monitor (1983) (13)
- Development of Genbu: Active-Wheel Passive-Joint Snake-Like Mobile Robot (2004) (13)
- Improvement of the remote operability for the arm-equipped tracked vehicle HELIOS IX (2010) (13)
- Characterization of the Column and Autocellular Junctions That Define the Vasculature of Gill Lamellae (2007) (13)
- Identification, Characterization and Evidence for Intraneuronal Function of Renin in the Brain and Neuroblastoma Cells (1982) (12)
- Development of walking and task performing robot with bipedal configuration (2001) (12)
- Moray Drive for multijoint manipulators (1991) (12)
- Legged Wall-Climbing Robot (1992) (12)
- Development of HELIOS IX: An Arm-Equipped Tracked Vehicle (2011) (12)
- The Standard Circular Gait of the Quadruped Walking Vehicle (1984) (12)
- The Basic Study of the Intelligent Gait Control for Quadrupedal Walking Vehicle (1982) (12)
- Design and Experiments of In-pipe Inspection Vehicles for ø25, ø50, ø150 Pipes (2000) (12)
- Actualization of safe and stable stair climbing and three-dimensional locomotion for wheelchair (2005) (12)
- Development of shape memory alloy actuator. (Improvement of output performance by the introduction of a .SIGMA.-mechanism) (1986) (12)
- Observation‐driven Bayesian Filtering for Global Location Estimation in the Field Area (2013) (12)
- The Gait Control System of the Quadruped Walking Vehicle (1985) (12)
- Fluorescence Visualization of Branchial Collagen Columns Embraced by Pillar Cells (2007) (12)
- PROPERTIES OF RAT UTERUS ENDOTHELIN RECEPTOR SITES (1990) (12)
- Purification and properties of active atrial-natriuretic-peptide receptor (type C) from bovine lung. (1989) (12)
- Ipriflavone down-regulates endothelin receptor levels during differentiation of rat calvarial osteoblast-like cells. (1999) (12)
- Scattering of elastic waves by a crack with spring-mass contact (1991) (12)
- Investigation on the Sensitivity of Ultrasonic Test Applied to Reinforced Concrete Beams Using Neural Network (2018) (12)
- Elastodynamic analysis of inhomogeneous anisotropic bodies (1986) (12)
- Damage model for simulating chloride concentration in reinforced concrete with internal cracks (2017) (12)
- Parallelized fast multipole BEM based on the convolution quadrature method for 3-D wave propagation problems in time-domain (2010) (12)
- Wet poly(vinyl chloride) membrane as a support: Sorption and transport of low-molecular-weight organic compounds and proteins (1982) (12)
- Protein kinase D regulates the human cardiac L‐type voltage‐gated calcium channel through serine 1884 (2011) (11)
- Visualization of ANP receptor on glomeruli of bovine kidney by use of a specific antiserum. (1987) (11)
- UNIQUE CONTRACTILE ACTION OF ENDOTHELINS ON PORCINE ISOLATED URETER AND CHARACTERIZATION OF THE ENDOTHELIN-BINDING SITES (1991) (11)
- LOCALIZATION OF RENIN mRNA IN THE MOUSE SUBMANDIBULAR GLAND BY IN SITU HYBRIDIZATION HISTOCHEMISTRY (1983) (11)
- HELIOS VII: a New Tracked Arm-Equipped Vehicle (2003) (11)
- A small noncontact ultrasonic motor (1993) (11)
- SPECIFICITY AND LOCALIZATION OF RENIN-BINDING PROTEIN(S) (1980) (11)
- Advanced child unit of “Anchor Climber” using modified internally-balanced magnet (2008) (11)
- Evaluation of Wave Barriers on Ground Vibration Reduction through Numerical Modeling in Abaqus (2009) (11)
- Stimulation of Na-K-Cl cotransport in cultured vascular endothelial cells by atrial natriuretic peptide. (1989) (11)
- Development of a Pneumatically Controlled Expandable Arm for Rescue Searches in Tight Spaces (2006) (11)
- An efficient steering control formulation for the articulated body mobile robot “KR-II” (1996) (11)
- New types child units of anchor climber: swarm type wall climbing robot system (2007) (11)
- 2 DOF Moray Drive For Hyper Redundant Manipulator (1992) (11)
- [Atrial natriuretic peptide receptors]. (1988) (11)
- SOLUBILIZATION AND CHARACTERIZATION OF ACTIVE ANGIOTENSIN II RECEPTORS FROM THE BOVINE ADRENAL CO RTEX (1984) (11)
- Identification and apical membrane localization of an electrogenic Na⁺/Ca²⁺ exchanger NCX2a likely to be involved in renal Ca²⁺ excretion by seawater fish. (2011) (11)
- Renin precursor and its activation mechanism in hog kidney. (1980) (11)
- A Moray Drive of Multi-joint Manipulator (1990) (11)
- Terrain Adaptive Tracked Vehicle HELIOS - I (1989) (11)
- Solubilization of endothelin receptors from bovine lung plasma membranes in a non-aggregated state and estimation of their minimal functional sizes. (1990) (11)
- Brief migration of the grass puffer, Takifugu niphobles, to fresh water from salt water (2010) (10)
- Ectopic production of renin by ileal carcinoma. (1989) (10)
- Evolution of trappin genes in mammals (2010) (10)
- Continuous high-speed climbing control and leg mechanism for an eight-legged stair-climbing vehicle (2009) (10)
- The S pole distribution on magnetic grains in pyroxenite determined by magnetotactic bacteria (1992) (10)
- Automation Technology for Humanitarian Demining Task (2001) (10)
- A dramatic pH-dependent alteration in ANP receptor density: a note for using cultured cells. (1993) (10)
- High-grip Stair Climber with Powder-filled Belts (2009) (10)
- Contact and Noncontact Ultrasonic Nondestructive Test in Reinforced Concrete Beam (2018) (10)
- PUTATIVE LIGAND-BINDING SITES OF THE TYPE C ATRIAL NATRIURETIC PEPTIDE RECEPTOR (1993) (10)
- Whole body autoradiography and microautoradiography in eels after intra-arterial administration of 125I-labeled eel ANP. (1996) (10)
- Numerical study on sub-harmonic generation due to interior and surface breaking cracks with contact boundary conditions using time-domain boundary element method (2017) (9)
- Formation of thiol groups in spinach chloroplasts by illumination (1971) (9)
- Damage Progression in Concrete Using Acoustic Emission Test through Convex Hull Visualization (2016) (9)
- Cell cycle-dependent changes in tissue transglutaminase mRNA levels in bovine endothelial cells. (1992) (9)
- Immunoreactive prorenin and its profragment peptide are present in human juxtaglomerular cells (1988) (9)
- Pillar cell and erythrocyte localization of fugu ET(A) receptor and its implication. (2007) (9)
- Ultrasonic Imaging of Concrete by Synthetic Aperture Focusing Technique Based on Hilbert-Huang Transform of Time Domain Data (2012) (9)
- COMPARATIVE STUDY ON ULTRASONIC IMAGING METHODS WITH ARRAY TRANSDUCERS (2008) (9)
- How to optimize the slope walking motion by the quadruped walking robot (2015) (9)
- Efficient Redundancy Control of Redundant Manipulators (1996) (9)
- HELIOS Tracked Robot Team: Mobile RT System for Special Urban Search and Rescue Operations (2011) (9)
- Study on Roller-Walker-Adaptation of Characeristics of the Propulsion by a Leg Trajectory- (2008) (9)
- Generalized Standard Leg Trajectory for Quadruped Walking Vehicle (1989) (9)
- Development of Dual Mode X-screw -A Novel Load-Sensitive Linear Actuator with a Wide Transmission Range- (2000) (9)
- Study of swing-grouser wheel: A wheel for climbing high steps, even in low friction environment (2015) (9)
- Proposal of Swarm Type Wall Climbing Robot System "Anchor Climber" and Development of Adhering Mobile Units (2010) (9)
- Development of a Quadruped Walking Robot TITAN XI for Steep Slopes Operation (2005) (9)
- Calcitonin receptor-like receptor (CLR) influences posttranslational events of receptor activity-modifying proteins (RAMPs). (2012) (9)
- Characterization of Damage Using Ultrasonic Testing on Different Types of Concrete (2018) (9)
- Impedance control of articulated body mobile robot "Koryu" (1993) (9)
- Crank-wheel: A brand new mobile base for field robots (2012) (8)
- Development of the Stair Climbing Leg-Wheel Hybrid Vehicle (2005) (8)
- Affinity chromatographic purification of bovine lung endothelin receptor using biotinylated endothelin and avidin-agarose. (1992) (8)
- Study of Walking Robot for 3 Dimensional Terrain (Optimization of Walking Motion Based on GDA and Coupled Drive). (1995) (8)
- Transverse surface waves in a piezoelectric material carrying a gradient metal layer of finite thickness (2009) (8)
- Na and Na /NH exchange activities of zebrafish NHE3b expressed in Xenopus oocytes (2014) (8)
- Development of the arm-wheel hybrid robot “Souki-II” (Total system design and basic components) (2009) (8)
- 3D Sway Compensation Trajectory for Quadruped Walking Robot (2001) (8)
- Attitude and Steering Control of the Long Articulated Body Mobile Robot KORYU (2007) (8)
- Development of the Insulator Washer robot (1995) (8)
- Development of coupled tendon-driven multijoint manipulator (1991) (8)
- Evaluation of Wheel Performance on Rough Terrain and Development of HS Wheel (2000) (8)
- A novel type of transverse surface wave propagating in a layered structure consisting of a piezoelectric layer attached to an elastic half-space (2010) (8)
- Nonlinear Ultrasonic Investigation of Concrete with Varying Aggregate Size under Uniaxial Compression Loading and Unloading (2017) (8)
- Development of “Souryu-IV” and “Souryu-V:” Serially connected crawler vehicles for in-rubble searching operations: Research Articles (2008) (8)
- Change in the expression of C-type natriuretic peptide and its receptor, B-type natriuretic peptide receptor, during dedifferentiation of chondrocytes into fibroblast-like cells. (1996) (8)
- Redundancy Decomposition Control for Multi-Joint Manipulators (1988) (8)
- Development of Leg-Wheel Hybrid Quadruped "AirHopper": Lightweight Leg-Wheel Design (2008) (8)
- Development of terrain adaptive sole for multi-legged walking robot (2010) (8)
- Effects of material gradient on transverse surface waves in piezoelectric coupled solid media (2009) (7)
- Functional Atrial Natriuretic Peptide Receptor in Human Adrenal Tumor (1988) (7)
- An Experimental Study of Teleoperation System for Walking Robots Using High-speed Image Stabilization System (2000) (7)
- Oxygen concentration-dependent induction of a 140-kDa protein in magnetic bacterium Magnetospirillum magnetotacticum MS-1 (1993) (7)
- Development of detachable tele-operation Gripper for the walking robot (2003) (7)
- Histological demonstration of glucose transporters, fructose-1,6-bisphosphatase, and glycogen in gas gland cells of the swimbladder: is a metabolic futile cycle operating? (2012) (7)
- Development of a light duty arm with an active-fingertip gripper for handling discoid objects (2010) (7)
- Pituitary Renin: Purification and Characterization (1982) (7)
- Development of Optical 6-Axial Force Sensor and Its Non-Linear Calibration (1990) (7)
- Robotic sensor with Photodetecting technology (1989) (7)
- A Dynamic Approach to Real-Time Obstacle Avoidance Control of Redundant Manipulators (1996) (7)
- Human adrenal tumor cell line SW-13 contains a natriuretic peptide receptor system that responds preferentially to ANP among various natriuretic peptides. (1990) (7)
- Application of Fast Multipole Boundary Element Method to Multiple Scattering Analysis of Acoustic and Elastic Waves (2007) (7)
- Terrain-Adaptive Quadru-Track Vehicle HELIOS II Multi-Media Display (1990) (7)
- Development of Slime Robot Using Bridle Bellows (2004) (7)
- Study on the brake operation of “Bridle Bellows” (2007) (7)
- Elastic wave scattering by inhomogeneous and anisotropic bodies in a half space (1989) (7)
- An Efficient Energy Generation and Distribution Scheme for Hyper-Tether Field Applications (2001) (7)
- Angiotensin converting enzyme inhibitor but not calcium blocker down-regulates gene expression of vascular natriuretic peptide receptor in hypertensive rats. (1994) (7)
- 3D Visual Information Processing and Gait Control of a Quadruped Robot - for operation on a steep slope protected by a free frame - (2003) (7)
- Sensor-Arm — robotic manipulator for preventive maintenance and inspection of high-voltage transmission lines (2008) (7)
- A SMALL NON-CONTACT ULTRASONIC MOTOR (1993) (7)
- Basic motion regulation of articulated body mobile robot (1989) (7)
- ISOLATION AND TRANSLATION OF RENIN mRNA FROM THE MOUSE SUBMANDIBULAR GLAND (1982) (7)
- Development of Tendon Driven Multi-Joint Manipulator Based on Coupled Drive (1990) (6)
- Development of tether mooring type underwater robot (2009) (6)
- Demonstration of the formation of renin and renin-binding protein complex using high-performance liquid chromatography. (1981) (6)
- Introduction of Mission Unit on Information Collection by On-Rubble Mobile Platforms of Development of Rescue Robot Systems (DDT) Project in Japan (2006) (6)
- Development of Steerable Endoscopes to Improve Depth Perception During Laparoscopic Surgery (2002) (6)
- Elastodynamic inversion of 3D cavity from backscattering data (1998) (6)
- Improved Landmine Discrimination With an Off - the-Shelf Metal Detector (2008) (6)
- A code of conduct for robots coexisting with human beings (1996) (6)
- Integration of Locomotion and Manipulation Control for Articulated Body Mobile Robots (2000) (6)
- Street Performance Robot Contest as Practice in Creativity Education (2011) (6)
- Cryptic Origin of SPAI, a Plasma Protein with a Transglutaminase Substrate Domain and the WAP Motif, Revealed by in Situ Hybridization and Immunohistochemistry* (1996) (6)
- Development of the Quadruped Walking Robot for Humanitarian Demining (Proposal of the System and Basic Experiment of Several Foot-end-effectors) (2000) (6)
- Cell-free translation of human renin mRNA. (1983) (6)
- Study on a practical robotic follower to support daily life — Development of a mobile robot with “Hyper-Tether” for Home Oxygen Therapy patients (2009) (6)
- Development and control of a buggy robot for operations on unstructured terrain (2002) (6)
- Development of dual mode X-screw: a novel load-sensitive linear actuator with a wide transmission range (1999) (6)
- Leg-wheel hybrid walking vehicle (Roller-Walker) (1998) (6)
- Guidelines for Human Interface Design of Rescue Robots (2006) (6)
- Separation and purification of 34- and 52-kDa species of bovine lung endothelin receptors and identification of the 34-kDa species as a degradation product. (1991) (6)
- Proposition and Basic Experiments of Shape Feedback Master-Slave Arm (On the Application for the Demining Robots) (2000) (6)
- Lack of atrial natriuretic peptide receptors in human aldosteronoma. (1988) (6)
- The study of a map realization system: consideration of real-time map generation (1989) (6)
- Piezoelectric impact force sensor array for tribological research on rigid disk storage media (1995) (6)
- Effects of covering layer thickness on Love waves in functionally graded piezoelectric substrates (2011) (6)
- Identification, Evolution, and Regulation of Expression of Guinea Pig Trappin with an Unusually Long Transglutaminase Substrate Domain* (2005) (6)
- Japanese sisters with Pfeiffer syndrome and achondroplasia: a mutation analysis. (1998) (6)
- Cooperative Positioning System with Multiple Robots. (1995) (6)
- Study on 3D Active Cord Mechanism with Helical Rotational Motion (2004) (6)
- Development of quadruped walking robot TITAN XII and its basic consideration on the control of large obstacle traversing motion (2014) (6)
- Mechanical Design of Joint Braking and Underactuated Mechanism of "Tri-Star3"; Horizontal Polyarticular Arm Equipped 3-Wheeled Expandable Mobile Robot (2006) (6)
- Development of the portable ground motion simulator of an earthquake (2013) (5)
- Design of Three-wheeled Planetary Rover Tri-StarII (2000) (5)
- Mechanical design of horizontal polyarticular expandable 3-wheeled planetary rover; "Tri-Star3" (2005) (5)
- Stabilizing Control for Dynamically Stable Walking of Quadruped Walking Robot (2001) (5)
- An empirical comparison of a free dynamics simulator “Open Dynamics Engine” with TITAN-VIII hardware torque/power measurements (2011) (5)
- Initial Experiments on the Control of a Mobile Tower Crane (2007) (5)
- Development of Tether Mooring Type Underwater Robots: Anchor Diver I and II (2011) (5)
- Proposition and basic experiments of shape feedback master-slave arm-on the application for the demining robots (2000) (5)
- Development of dinosaur-like robot TITRUS - its dynamics and the motion utilizing the dynamic effect of the neck and tail (2003) (5)
- A new design criterion in robotic mechanism (prevention of negative power consumption) (1993) (5)
- From blood typing to a transport metabolon at a crossroad. Focus on "Ammonium-dependent sodium uptake in mitochondrion-rich cells of medaka (Oryzias latipes) larvae". (2010) (5)
- Basic consideration about optimal control of a quadruped walking robot during slope walking motion (2013) (5)
- Article Book (2022) (5)
- Angiotensin converting enzyme inhibitor normalizes vascular natriuretic peptide type A receptor gene expression via bradykinin-dependent mechanism in hypertensive rats. (1996) (5)
- Active wheel passive joint articulated mobile robot (2002) (5)
- Euryhaline pufferfish NBCe 1 differs from nonmarine species NBCe 1 physiology (2012) (5)
- A self-contained and terrain-adaptive active cord mechanism (1998) (5)
- A novel long-reach robot with propulsion through water-jet (2016) (5)
- Development of Snake Robots for Rescue Operation : Design of the Shape and Its Control( Disaster Response Robotics) (2003) (5)
- Affinity labeling of ACTH receptors in bovine adrenal cortex membranes. (1989) (4)
- Design of Nonlinear Spring and Mechanism for Internally-balanced Magnetic Unit (2009) (4)
- A numerical modeling of contact SH-wave transducers (2001) (4)
- Fast Imaging of 3‐D Flaw Using Linearized Inverse Scattering Methods (2004) (4)
- Endothelins inhibit mineralization of rat calvarial osteoblast-like cells. (1998) (4)
- Development of dinosaur-like robot TITRUS - the efficacy of the neck and tail of miniature dinosaur-like robot TITRUS-III (2003) (4)
- Optimal load-sensitive control for mobile robots equipped with continuously variable transmissions (2001) (4)
- Title Quadruped Walking Robots at Tokyo Institute of Technology : Design , Analysis , and Gait Control Methods (2018) (4)
- A Study of Active Cord Mechanisms -Biomechanical Consideration on its 3D Gaits- (2003) (4)
- Position Identification of Mobile Robot by Range Information (1991) (4)
- Identification of the primary translation product of atrial natriuretic peptide receptor mRNA in a cell-free system using anti-receptor antiserum. (1987) (4)
- Microwave-Assisted Extraction of Protoberberine Alkaloids from Coscinium fenestratum (2009) (4)
- Six-axis force control for walking robot with serial/parallel hybrid mechanism (1999) (4)
- Development of X-screw. A load-Sensitive Actuator Incorporating a Variable Transmission. (2000) (4)
- Mechanical Design of VmaxCarrier2: Omnidirectional Mobile Robot with Function of Step-Climbing (2005) (4)
- Frontiers in Aquatic Physiology – Grand Challenge (2010) (4)
- Reflection and scattering analysis of sh-wave using a combined method of BEM and ray theory (2000) (4)
- Development of Teleoperated Landmine Detection Buggy GRYPHON for Practical Humanitarian Demining Tasks (2006) (4)
- PLASMA INACTIVE RENIN IN NORMAL SUBJECTS AND PATIENTS WITH DIABETIC NEPHROPATHY AND RENINSECRETING TUMORS: COMPARISON WITH RENAL RENIN (1982) (4)
- Development of mechanical master-slave hand for demining operation (2004) (4)
- Stair Climbing Robots and High-Grip Crawler (2010) (4)
- Terrain Modeling and Following Using a Compliant Manipulator for Humanitarian Demining Applications (2009) (4)
- Preparation and properties of β-glucuronidase immobilized on a polyvinylchloride membrane (1980) (4)
- Study on Ankle Mechanisms for Walking Robots -Fundamental Considerations on its Functions and Morphology- (2004) (4)
- Mechanism of activation of particulate guanylate cyclase by atrial natriuretic peptide as deduced from radiation inactivation analysis. (1989) (4)
- R-Crank: Amphibious all terrain mobile robot (2016) (4)
- 2A2-L08 Development of articulated spherical wheeled in-pipe robot "ThesV"(Mobile Robot with Special Mechanism) (2011) (4)
- A Large Scale Simulation of Ultrasonic Wave Propagation in Concrete Using Parallelized EFIT (2008) (4)
- Three Axes Force Sensor Using Split Type Optical Sensor (1989) (4)
- Tethered Detachable Hook for the Spiderman Locomotion (Design of the Hook and Its Launching Winch) (2009) (4)
- A Computed Torque Method Based Attitude Control with Optimal Force Distribution for Articulated Body Mobile Robots (2000) (4)
- THEORETICAL ANALYSIS OF SEISMIC WAVES IN A DIPPING LAYER (1983) (4)
- Development of the dynamic motion simulator of 3D micro-gravity with a combined passive/active suspension system (1994) (4)
- Contacting Surface-Transfer Control for Reconfigurable Wall-Climbing Robot Gunryu III (2013) (4)
- Snakes and Strings (2002) (4)
- Telerobotic Control System to Enhance Rescue Operations for Arm-Equipped Tracked Vehicle HELIOS IX (2014) (4)
- Design of Hyper-Redundant Arm (1996) (4)
- An Optimal Steering Control for the Articulated Body Mobile Robot (1994) (3)
- Proposition of the humanitarian demining system by the quadruped walking robot-adaptability for various tasks using the foot-end-effecter changing mechanism (2000) (3)
- 1P1-J03 Proposal of a Crank Wheel Robot and its Fundamental Experiment(Wheeled Robot/Tracked Vehicle) (2011) (3)
- [Heterogeneity of G protein-coupled receptor generated by post-translational mechanisms and its clinical meanings]. (2004) (3)
- Development of Deminer-Assisting Robotic Tools at Tokyo Institute of Technology (2008) (3)
- DEVELOPMENT OF 3D FLAW DETECTION SYSTEM WITH MULTI-CHANNEL PLANAR ARRAY PROBES AND 3D SAFT ALGORITHMS (2005) (3)
- Development of Anchor Diver III: Easy-to-Operate Tensioned-Tether Type ROV for Underwater Search and Rescue Operations (2012) (3)
- Improvement of SAFT by Implementation of Approximate Wave Solution in Fluid-Solid Two-Phase Media: A Case Study on Imaging of Aluminum Rod with Side-Drilled Holes (2015) (3)
- Modeling of Phased Array Transducer and Simulation of Flaw Echoes (2007) (3)
- Retrotransposons transcribed preferentially in proximal tubules of salt-hypertensive rats. (1999) (3)
- Introduction of "Intelligent Sport" (1998) (3)
- Selective colocalization of transglutaminase-like activity in ubiquitinated intranuclear inclusions of hereditary dentatorubral-pallidoluysian atrophy (2002) (3)
- Large‐Scale Multiple Scattering Analysis Using Fast Multipole BEM in Time‐Domain (2010) (3)
- A 2-D Hypersingular Time-Domain BEM for Dynamic Crack Analysis in Generally Anisotropic Solids (2007) (3)
- Immunohistochemical Analysis of Cerebral Intraparenchymal Choroid Plexus Tumor: Case Report (2018) (3)
- Improved ultrasonic SAFT imaging of flaws in structures with curved surfaces (2014) (3)
- A2-M02 Development of the articulated spherical wheeled in-pipe robot "ThesV":2nd report:Mechanism improvements and comprehensive experiments of piping corrosion inspection(Mobile Robot with Special Mechanism(2)) (2012) (3)
- Dynamic Control Approaches for a Coupled Tendon-Driven Manipulator. (1995) (3)
- Non-Tumbling Gait and directional normalized energy stability margin (2013) (3)
- Application of wave barriers as a countermeasure against train-induced ground vibrations (2010) (3)
- Development of Mine Hand: An Extended Prodder for Protected Demining Operations (2005) (3)
- Neuroblastoma GOTO cells are hypersensitive to disruption of lipid rafts. (2009) (3)
- Inverse scattering of elastic waves for a cavity. (1986) (3)
- Wall Gait : A Standard Gait for the Quadruped Wall-Climbing Robot (1995) (3)
- 1A1-D28 Development of Wheeled type jumping quadruped (2006) (3)
- Armrest Joystick -mechanism design and basic experiments- (2012) (3)
- Minimal functional size of porcine lung and testicular angiotensin‐converting enzymes deduced from radiation inactivation analysis Interaction of two highly homologous domains in somatic isoenzyme (1992) (3)
- 3‐D Flaw Imaging by Inverse Scattering Analysis Using Ultrasonic Array Transducer (2007) (3)
- Interface Crack in Anisotropic Solids under Impact Loading (2007) (3)
- Ligand-induced internalization, recycling, and resensitization of adrenomedullin receptors depend not on CLR or RAMP alone but on the receptor complex as a whole. (2015) (3)
- Humanitarian Demining Robot Gryphon – An Objective Evaluation (3)
- A dispute over robots. Robots of the future (1991) (3)
- Determination of ammonia with a Stark microwave cavity resonator (1982) (3)
- Development of Vmax III: Magnetic Wall Climbing Robot with Holonomic and Omni-directional Mobility (2012) (3)
- SORPTION AND TRANSPORT OF ACETYLCHOLINE IN RECONSTITUTED BIOMEMBRANE STRUCTURES (1983) (3)
- The Development of an Autonomous Robot System for Patrolling in Multi-Floor Structured Environment (2012) (3)
- 1A1-H01 Development of a Portable Field Arm with Gravity Compensation (2008) (3)
- Developement of Disk Rover, Wall-Climbing Robot using Permanent Magnet Disk (1992) (3)
- Development of an Educational Fish-like 1-DOF Gliding Locomotion Robot with Passive Wheels (2013) (3)
- ANGIOTENSIN II-BINDING ACTIVITY RESIDES ON A 170-KILODALTON POLYPEPTIDE AS REVEALED BY PARTIAL PURIFICATION AND AFFINITY LABELING (1986) (3)
- Study on Cooperative Positioning System. Development of Cleaning Robot System with CPS-III. (1998) (3)
- GENE EXPRESSION OF VASCULAR NATRIURETIC PEPTIDE RECEPTOR IN THE AORTA OF HYPERTENSIVE RATS (1995) (3)
- Crack Growth Analysis in Anisotropic Solids (2001) (2)
- Tri-axial force sensor using a split-type optical sensor (1990) (2)
- The Effect of Anisotropy On the KI Calibration of ISRM Standard Fracture Toughness Specimens (1995) (2)
- Design Guidelines for Human Interface for Rescue Robots (2009) (2)
- Trot gait based feed-forward walking on challenging terrain: Case of high step climbing (2015) (2)
- Seawater fish use an electrogenic boric acid transporter, Slc4a11A, for boric acid excretion by the kidney (2022) (2)
- The study of a map realization system (cancellation of ambient light and swaying motion of a robot) (1987) (2)
- Design of Active Cord Mechanism ACM-R2 to Realize 3-D Motions (2001) (2)
- 1P1-N-048 Teleoperated Buggy Vehicle and Weight Balanced Arm System for Mechanization of Mine Detection Tasks : Fault-tolerant and Fail-safe Distributed Control(Mobile Manipulation Robot 2,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (2)
- Development of novel linear motion mechanism with compact three-staged transmission (2005) (2)
- Innovation of Creative Engineering through the Development of Advanced Robotics (2007) (2)
- Development of Robotic Systems for the Decommissioning Operation of Fukushima-Daiichi Nuclear Reactor (2013) (2)
- Processing and Subunit Structure of Ig-Hepta, a Seven-transmembrane Receptor with a Long N-terminal Extracellular Domain* CLEAVAGE AT A “SEA” MODULE AND AT A CONSERVED GPCR PROTEOLYTIC (2002) (2)
- Research On Hyper-Tether : No.12 Development of launching and anchoring gripper (2002) (2)
- Structure of the Bovine Endothelin‐B Receptor Gene and Its Tissue‐Specific Expression Revealed by Northern Analysis (1992) (2)
- Implicit Runge-Kutta Based Convolution Quadrature Time-domain Fast Multipole Boundary Element Method for 3-D Scalar Wave Problems (2013) (2)
- Purification of human plasma inactive renin by immunoaffinity chromatography on profragment-specific IgG. (1986) (2)
- Bie Analysis of Elastic Wave Scattering by a Nonlinear Interface (1992) (2)
- 3-D Analysis of the Influence of a Pile on Underground Induced Vibrations Using the Boundary Element Method (2010) (2)
- Motions on steps and slopes of omni-directional mobile robot, "VmaxCarrier2" (2005) (2)
- Mechanical design and tests of HELIOS VII, a tracked vehicle for disaster response (2004) (2)
- Characterization of the zebrafish cx36.7 gene promoter: Its regulation of cardiac-specific expression and skeletal muscle-specific repression. (2016) (2)
- A novel wide purpose leg-wheel hybrid mobile vehicle (2004) (2)
- Fndc4, a highly identical ortholog of Irisin binds and activates a novel orphan receptor G-protein coupled receptor (2016) (2)
- Development of under-supporting extension hand for tableware handling (New concept of the hand for stable handling and its design for arm system) (2013) (2)
- Development of Under-Supporting Extension Hand (new concept of the hand for stable tableware handling) (2010) (2)
- Development of robot remote controller "Armrest Joystick" — Study of bilateral remote control (2015) (2)
- Intelligent autonomous systems, IAS--3 : Proceedings of the international conference, Pittsburgh, Pennsylvania, February 15-18, 1993 (1993) (2)
- Partial Leg Exchange and Active CG Control of Twin-Frame Walking Machine (2000) (2)
- Rat chondrocyte proliferation was regulated by natriuretic peptide C and its receptor, natriuretic peptide receptor-B, in autocrine manner (1994) (2)
- 2P1-E19 Development of Souryu-VII with active slime body and multiple wheels (2009) (2)
- Development of Quadruped Walking Robot TITAN-VIII and Motor Driver TITECH Driver (2005) (2)
- Development of biologically inspired educational robots based on gliding locomotion (2013) (2)
- 2A1-J06 Development of Casting Hook with Tele-operated Releasing Function : Consideration of Electric and Pneumatic Tele-driving Mechanism (2007) (2)
- 2 DOF Moray Drive for Multijoint Manipulators (1996) (2)
- CO-LOCALIZATION OF ANGIOTENSIN II AND RENIN IN GROWTH HORMONE-CONTAINING CELLS OF THE BOVINE PITUITARY (1985) (2)
- Study of stair-climbing assistive mechanisms for the disabled (2018) (2)
- Properties of renin-binding protein. (1982) (2)
- Mechanical Design and Basic Run Experiments with the Tri-StarIII - Horizontal Polyarticular Expandable 3-Wheeled Planetary Rover - (2008) (2)
- BEM Analysis of Wave Propagation in a Water-Filled Borehole in an Anisotropic Solid (2007) (2)
- RENIN INHIBITOR IN THE SUBMAXILLARY GLAND OF MALE MOUSE (1981) (2)
- Variable Constraint Mechanism and Its Design (1999) (2)
- Development of a Mechanical Master-slave Hand for Demining (2003) (2)
- Development of image sensor unit for rescue devices (2005) (2)
- Pneumatically-Driven Active Cord Mechanism "Slim Slime Robot" (2014) (2)
- Simulation of Higher Harmonics on Nonlinear Ultrasonic Testing Using Convolution Quadrature Time-Domain Boundary Element Method in 2-D Elastodynamics (2011) (2)
- Development of the stair climbing leg-wheel hybrid vehicle Zero Carrier (2002) (2)
- Development of Uneven-Surface-Adaptive Permanent Magnet Unit (2008) (2)
- SCATTERING OF ANTIPLANE WAVES BY INHOMOGENEOUS ALLUVIAL VALLEYS (1985) (2)
- Differential gene expression of vascular natriuretic peptide receptor subtype in artery and vein. (1995) (2)
- Scattering from an Interface Defect Between Fiber and Matrix (1995) (2)
- Is Robot Contest Valuable (1997) (2)
- Transverse Surface Waves in a Functionally Graded Substrate Carrying a 6mm Piezoelectric Material Layer (2010) (2)
- Numerical Simulation of Scattered Waves from Flaws for Ultrasonic Array Transducer (2007) (2)
- First Annual Conference (1984) (2)
- ALL-N-020 Design and control of amphibous snake-like robot ACM-R5(Prototype Development Support Enterprise, Next-Generation Robot Commercialization Project,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (2)
- Multiple Scattering Approximation of Anti-plane Elastic Waves in Infinite and Half-Space Domains with Distributed Inclusions (2007) (1)
- Effects of seating arrays on subjective quality in auditoria (2001) (1)
- Inertial Reference Frame Based Steering Control for The Articulated Body Mobile Robot (1996) (1)
- Crouzon Syndrome with Acanthosis Nigricans: Case Report and Mutational Analysis (2000) (1)
- 1A1-D39 Study of swarm type robot "Anchor Climber" : No.2 Development of "Child Unit" adopted new type of IB magnet unit (2006) (1)
- 2P1-S-057 Development of a Quadruped Walking Robot to Work on Slopes, TITAN XI : 5th Report: The Walk to Avoid the Concrete Flames on a Steep Slope(Construction Robot and Mechatronics 2,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (1)
- Transport of acetylcholine in a membrane (1984) (1)
- Czech Society for Nondestructive Testing 32 nd European Conference on Acoustic Emission Testing Prague , Czech Republic , September 07-09 , 2016 MONITORING DAMAGE IN REINFORCED CONCRETE STRUCTURE USING SEESAW EFFECT THROUGH ACOUSTIC EMISSION TEST (2018) (1)
- A Development of the 3D Micro-Gravity Simulator with a Combined Passive/Active Suspension System (1995) (1)
- From biologically-inspired robots to reality: Snake and quadruped walking (2008) (1)
- 2A1-J05 Development of a Load-Sensitive Dual States Transmission with a Twoway Clutch (2007) (1)
- Walking robot for humanitarian demining (1998) (1)
- Two Decades of Locomotion Study (2002) (1)
- Biomechanical Study on Serpentine Locomotion Gliding Shape of Snake in Stationary Straightforward Movement (1974) (1)
- Development of Detachable Teleoperation Gripper for a Walking Robot (2003) (1)
- Study of Super Mechano-Systems: Center of Excellence Project in TITech (2000) (1)
- A Dialog on Robot (1989) (1)
- Study on a practical robotic follower to support home oxygen therapy patients — Questionnaire-based concept evaluation by the patients- (2013) (1)
- A Green’s Function Boundary Element Method for SH‐Wave Scattering in an Elastic Layer (2004) (1)
- Whisker Sensor and Transmission of the Multiple Sensor Signals (1988) (1)
- Study on turn motion of child rovers of a reconfigurable planetary rover system (2005) (1)
- Signal processing of a range-finder map-realization system (1987) (1)
- High Molecular Weight Renins in Spontaneously Hypertensive Rat and Stroke-Prone Spontaneously Hypertensive Rat (1977) (1)
- Development of spherical-trailer-type cable reel mechanism (2007) (1)
- 1A2-Q01 Development of False Alarm Reduction Method of Metal Detector with Robotic Arm for Humanitarian Demining(Robotics for Hazardous Fields) (2011) (1)
- On-Rubble Robot Systems for the DDT Project (2009) (1)
- Proposition and Basic Experiments of Shape Feedback Master-Slave Arm (2000) (1)
- Humanitarian Demining Operation Using the Teleoperated Buggy Vehicle Gryphon with a Mine Sensors Equipped Arm (2009) (1)
- Development of a Quadruped Walking Robot to Work on Slopes, TITAN XI : 4th Report : Gait Generation Based on the Intermittent Crawl Gait (2004) (1)
- Study on Slime Robot : Development of bridle bellows prototype model and characteristic test (2003) (1)
- Signal Processing of Map Generating Range Finder (1984) (1)
- Synthesis of Enzymatically Active Mouse Submandibular Gland Renin in Escherichia coli (1986) (1)
- Study of Discrimination Methods for Metal Fragments and Mines in Humanitarian Demining Tasks (2010) (1)
- 1P1-S-073 Development of Hemispherical Wheel Trailer Equipped with Reel Mechanism for Cable Communication Type Rescue Robot(Rescue System and Rescue Engineering 2,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (1)
- Development of pantograph-type robot arm equipped with 3-dimentional gravity compensation mechanism (2017) (1)
- Non-Linear Ultrasonic Test for Fiber-Reinforced Concrete using 3rd Harmonic Generation (2015) (1)
- ACCELERATION OF THE 3D IMAGE-BASED FIT WITH AN EXPLICIT PARALLELIZATION APPROACH (2012) (1)
- Development of falcon III: Terrain-adaptive body-stabilizing three-wheeled vehicle (2010) (1)
- 1P1-A12 Design of an Active Cord Mechanism for Underwater Spiral Propulsion (2001) (1)
- 2P1-D07 Development of Large Wheeled Snake-Like Robot "ACM-R8" (2015) (1)
- Lessons Learned from Field Tests in Croatia and Cambodia (2008) (1)
- Na+/HCO3− cotransporter 4 (NBC4) predominantly expressed in choroid plexus is involved in cerebrospinal fluid production (2006) (1)
- 1A1-E06 Development of a Passive Terrain Adaptive Sole for a Quadruped Walking Robot (2008) (1)
- Partial Analysis Method Combined with Mode-exciting Method in the Analysis of Lamb Waves Scattering by a Crack in a Plate (2005) (1)
- Development of miniature dinosaur-like robot TITRUS-III (2001) (1)
- ACOUSTICAL ANISOTROPY AND NON-HOMOGENEITY OF ROLLED STEEL PLATES (2004) (1)
- An optimization method for the design parameters of a linear phased array transducer using radiation pattern of the incident field (2003) (1)
- FastWalking with Consideration of an Acceleration and a Deceleration for a Quadruped Robot (2015) (1)
- A new time-domain boundary element method using the operational quadrature method and the fast multipole method in 2-D elastodynamics (2008) (1)
- BEM ANALYSIS OF LAMB WAVE SCATTERING BY LAYERED PLATE DEBONDING (2021) (1)
- IN-PIPE INSPECTION ROBOT (2012) (1)
- Study on Cooperative Positioning System. Map Creation by CPS Based Active Touch. (1999) (1)
- Geometrical Resolution of Defects in Linearized Inverse Scattering Methods (1998) (1)
- Development of Cable Reel for Spherical Trailer - Uniform Cable Winding (2008) (1)
- Research on a Reduced-DOF Walking Robot with Parallel Mechanism that has High Homogeneity of Output Force (2000) (1)
- The study of map realization system (Canceling of ambient light and swaying motion) (1986) (1)
- Improved Time-Domain BEM Analysis for a Solid-Solid Interface with Contact Boundary Conditions (2010) (1)
- Simulation for air-coupled ultrasound testing using time-domain BEM (2014) (1)
- Detection and Thickness Estimation of Water Layer in Layered Medium Based on Multi-Reflection of Oblique Incident Ultrasonic Wave (2016) (1)
- RADIORECEPTOR ASSAY FOR ATRIAL NATRIURETIC PEPTIDE USING PURIFIED RECEPTOR (1990) (1)
- SH Wave Scattering by a Defect in a Plate (1998) (1)
- THREE DIMENSIONAL SIMULATION OF ULTRASONIC MULTIPLE SCATTERING BY DISTRIBUTED AGGREGATES IN CONCRETE AND ITS VALIDATION WITH MEASURED SIGNALS (2014) (1)
- Flaw Shape Reconstruction from SH‐Wave Array Ultrasonic Data Using Time Domain Linearized Inverse Scattering Method (2005) (1)
- The Standing Posture Transformation Gait of the Quadruped Walking Vehicle (1986) (1)
- Development of a New Type of Personal Vehicle for Rough-Terrain Applications (2011) (1)
- Development of a Mine Detection Arm Mounted on a Compact Vehicle (2003) (1)
- Morphological and functional characterization of a novel Na+/K+-ATPase-immunoreactive, follicle-like structure on the gill septum of Japanese banded houndshark, Triakis scyllium (2012) (1)
- Functional Characterization of Pufferfish Slc26a6A and Slc26a6B (2008) (1)
- Failure Modeling of Quasi-Brittle Materials by Low-Order Finite Elements and Stress-Based Gradient Damage Model (2017) (1)
- Application of the BEM to Elastodynamics in a Three Dimmensional Half Space (1986) (1)
- Development of Load-Sensitive Continuously Variable Rotary Transmission : Vol. 2 Improvement of Efficiency (2002) (1)
- APPLICABILITY OF EFFECTIVE REGION TECHNIQUE IN ULTRASONIC IMAGING BY AWS-SAFT (2015) (1)
- Inversion of Vibration Mode of an Immersion Ultrasonic Transducer (2002) (1)
- Integration of Arm-equipped Mobile Robot GRYPHON for Humanitarian Demining Operation (2007) (1)
- Design and basic experiments of a waterproof mobile robot propelled by RS-Wave mechanism (2013) (1)
- Study on Cooperative Positioning System. Optimized Moving Strategy for the CPS-II System. (1997) (1)
- 1A2-Q03 Development of Tethered Detachable Hook IV for Robot Locomotion in Extremely Rough Environments(Robotics for Hazardous Fields) (2011) (1)
- 1P1-N-047 Teleoperated Buggy Vehicle and Weight Balanced Arm System for Mechanization of Mine Detection Tasks : Automatic Scanning of Mine Fields based on Stereo Vision(Mobile Manipulation Robot 2,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (1)
- Inverse Scattering Analysis for a Defect in a Plate (2001) (1)
- Development of Novel Linear Motion Mechanism with Load Sensitive Transmission (2006) (1)
- Design of Snake Like Vehicle: Articulated Body Moblie Robot KR II (1991) (1)
- Numerical and Experimental Studies on the Scattering of Lamb Waves in a Bent Plate (2006) (1)
- Numerical Simulation of Rock Toughness Testing (1993) (1)
- Study on Slime Robot : Realization of Bridle Bellows and study on gaits of SSR-□ (2002) (1)
- Far-Field Analysis of Ultrasonic Testing for an Anisotropic Thick Steel Plate (2002) (1)
- Application of wave barriers as a countermeasure against train-induced ground vibrations : R. Motamed K. Itoh (2010) (1)
- "Tri-Star3"; Horizontal Polyarticular Arm Equipped 3-Wheeled Expandable Rover (2006) (1)
- Simulation of Non‐Linear Ultrasonic Wave through an Interface Including Imperfections (2006) (1)
- Study of Active Cord Mechanism ACM-R7 Capable of Loop-Gait Locomotion (2010) (1)
- Teleoperated Buggy Vehicle and Weight Balanced Arm System for Mechanization of MineDetection Tasks - Fault-tolerant and Fail-safe Distributed Control (2005) (1)
- Development of Gryphon-I : Autonomous Buggy Robot for Off-Road Applications (2002) (1)
- A 3D boundary integral equation method for ultrasonic scattering in a fluid-loaded elastic half space (2002) (1)
- 1A1-D20 Development of wall-climbing robot of magnetic adsorption type used of principle of omni directional Mobil robot "V max" (2008) (1)
- Quantitative ultrasonic nondestructive evaluation and related technology (2004) (1)
- MODELING OF IMMERSION ULTRASONIC TESTING AND SIMULATION OF SCATTERED WAVES BY FLAWS (2006) (1)
- The Development of The Head Unit for The Extensible Arm to Rescue : The Pneumatically Driven Bending Mechanism and The Air Blower to Keep Camera Sight Clear (2004) (1)
- Scattering Analysis and Simulation for Lamb Wave Ultrasonic Testing (1996) (1)
- 1A1-M2 Development of Load-Sensitive Continuously Variable Rotary Transmission : Vol.1 A proposition of basic mechanism (2001) (1)
- Inverse Scattering Analysis for Crack in General Anisotropic Elastic Solids Using Pure SH Wave (2018) (0)
- Predictive Dynamics-Based Motion Control for the Rough-Terrain Locomotion of the Personal Vehicle Falcon-III (2011) (0)
- 1A1-S-082 Development of self-oscillating fluid motor using wave-shaped cam(Mechanism and Control for Actuator 1,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- Virtual Robot Experimentation Platform - A Versatile Small Footprint Robot Simulator (2008) (0)
- 2A1-P07 Development of ACM-R4.2: Active-Joint Active-Wheel High Terrain Traversability Snake-like Robot(Search and Rescue Robot and Mechatronics(1)) (2012) (0)
- Mobile Components—Integration of Drive, Control and Sensor Systems— (2003) (0)
- Teleoperated Buggy Vehicle and Weight Balanced Arm System for Mechanization of MineDetection Tasks - System Integration and Field Evaluation Tests (2005) (0)
- 2A2-K03 Workspace Maximization of the 2-DOF Spherical Parallel Mechanisms(Parallel Robot/Mechanisms and its Control) (2013) (0)
- 2A2-P15 Recovery from falling over of active wheel-type snake-like robot based on torque and attitude control(Mobile Robot with Special Mechanism (2)) (2013) (0)
- Snake-Type Robot (1989) (0)
- 1P1-B05 Proposition of a cable reel using an oscillating level winder arm(Smart Mechanism "sMechanism" and its Control) (2014) (0)
- Mechanism and Control of "Genbu" : Articulated Multi-Wheeled Mobile Robot (2002) (0)
- 2A2-C04 Study on a Practical Robotic Follower to Support Home Oxygen Therapy Patients : Questionnaire-Based Concept Evaluation by Patients(Welfare Robotics and Mechatronics (2)) (2013) (0)
- 1P1-C09 Development of visual system for the operation assistance of a mobile manipulator, "HELIOS X"(Robotics for Hazardous Fields) (2012) (0)
- 1A1-F04 Development of a Track-changeable Quadruped Walking Robot, TITAN X : 1st Report: Design of Leg Driving Mechanism (2007) (0)
- Study on pneumatic mobile robot (2002) (0)
- 2A1-S-018 Development of a three-wheeled robot movable on narrow and uneven terrain(Mobile Robot 3,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- Development of the light-legged dinosaur TITRUS (1998) (0)
- Methodology of Breakthrough in the Creative Design of Robots (2014) (0)
- 2A1-G18 Design of Arm Equipped Single Wheel Rover "Soki2" and its Cooperative Operation : Examination of traverse ability in unleveled ground (2008) (0)
- Development of Omni-Disc for Omni-Directional Mobile Robot with the Function of Step Climbing (2003) (0)
- 2P1-S-056 Development of a Quadruped Walking Robot to Work on Slopes, TITAN XI : 6th report: The Generation and the Use of 3D Map Information of Slopes(Construction Robot and Mechatronics 2,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- Mechanism and Actuator (1990) (0)
- Development of a Quadruped Walking Robot to Work on Slopes, TITAN XI : 3rd Report : Design of Hydraulic Servo System for Legs and Its Basic performance (2004) (0)
- Development of Far-reach Tethered Working Tool between Mobile Platforms: -3rd Report: Grass Cutting System by Tethered Working Tool and Verification Experiment- (2018) (0)
- 2A1-J07 Locomotion on uneven terrain by snake-like robots equipped with a touch sensor on the head (2007) (0)
- Guest Editorial (2005) (0)
- Study on the Wall Gait for a Wall-climbing Robot with Reduced DOF (2002) (0)
- 2P2-E14 Development of Mobile Vehicle "Raccoon-I" : Bending-Body with Multi-Wheels (2006) (0)
- Development of the Rover at Hirose Laboratory of Tokyo Institute of Technology (2014) (0)
- From Humanoid to Robot with Emerged Machine Intelligence (1998) (0)
- 2 DOF Moray Drive for Hyper Redundant Mani~~l~t~~ (1992) (0)
- Feedback and predictive motion control strategies for the off-road locomotion of the three-wheeled personal vehicle Falcon-III (2011) (0)
- IEEEICIT2007Conference Programata Glance (2007) (0)
- Creativity Education through Street Performance Robot Contest and a Questionnaire Survey for Alumni (2013) (0)
- 2P1-S-094 Development of the pneumatic in-car jack applicable for the rescue use(Rescue System and Rescue Engineering 5,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- 2A2-L13 Proposition of Surface Wave Mechanism and Its Application for Watertight Mobile Robots(Mobile Robot with Special Mechanism) (2011) (0)
- Session Summary (2003) (0)
- 2P1-S-033 Development of Horizontal Polyarticular Expandable 3-wheeled Planetary Rover Tri-StarIII : Optimization design of cam profile for braking mechanism(Mobile Robot with Special Mechanism 2,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- Development of the Isulator Washer Robot. (1995) (0)
- 2A1-H21 Design of Amphibious Active Cord Mechanism ACM-R7 with Large Joint Motion Range (2008) (0)
- Dispositif de joint elastique (2006) (0)
- The Rescue Robot and the Soft Material (2005) (0)
- 2A2-C04 Development of Generation System for Submarine Robot (2007) (0)
- Robotic Technology for Disaster Relief (2012) (0)
- 1P1-R01 Development of weight compensation wheeled suit for radiation protection(Wearable Robotics) (2013) (0)
- 2P1-O02 Development of Underwater ROV for checking dams : Fabrication and practical experiment (2015) (0)
- Development of rescue robots in Tokyo institute of technology (2004) (0)
- 1A2-Q02 Development of Detachable Mine Detection Manipulator for Demining Heavy Machinery(Robotics for Hazardous Fields) (2011) (0)
- Crawler crawler device and method for manufacturing the crawler (2004) (0)
- Robotist View of Biology (1994) (0)
- Locomotion of a Hyper-Redundant Mobile Robot : Sinus-lifting (2002) (0)
- Robots and Society of the Future (1992) (0)
- 2A1-S-044 Design of Novel GDA (Gravitationally Decoupled Actuation) type leg with large motion range(Walking Robot 1,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- 2P2-F08 Study on a Practical Robotic Follower to Support Daily Life : Part 1:Proposal of a Mobile Robot with the "Hyper-Tether" to Carry an Oxygen Tank (2008) (0)
- SkyScraper-I: Tethered Whole Windows Cleaning Robot -Design of Moving Mechanisms and Preliminary Experiments- (2010) (0)
- 1A1-C03 Development of Actuator Unit for Operation Under Extreme Environmental Conditions : Evaluation using Actual Mobile Robots (2006) (0)
- Development of a Leader-following Mobile Robot to Support Home Oxygen Therapy Patients (2012) (0)
- Hybrid Hash Join Algorithm with Bucket Regrouping on Map/Reduce (2013) (0)
- Hybrid locomotion of Bipedal Robot with disk type sole (2002) (0)
- Control method for gliding locomotion (2001) (0)
- Identification of SAMT family proteins as substrates of MARCH11 in mouse spermatids (2011) (0)
- Hirose excretion by seawater fish 2 + involved in renal Ca exchanger NCX 2 a likely (2014) (0)
- Contents Vol. 9, 2001 (2001) (0)
- ICCAS-SICE 2009 Organizing Committee (2009) (0)
- Proposal of Mechanical Prodding System for humanitarian Demining Operation (2004) (0)
- A novel variant of the Na+/HCO3 (2013) (0)
- 2A1-S-031 The Development of Practical 3-dimensional Active Cord Mechanism ACM-R4(Mobile Robot with Special Mechanism 1,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- 1A1-R10 Development of active-wheeled snake-like robot operatable in narrow spaces of the nuclear plant(Robotics for Hazardous Fields) (2013) (0)
- 2A2-V09 Study on a Practical Robotic Follower to Support Daily Life : Part5 : Improvement of rhomboid layout four-wheel vehicle with considering the usability(Welfare Robotics and Mechatronics (3)) (2012) (0)
- 2P1-S-016 Development of Arm-Wheel Hybrid Robot Souki : Basic Experiment on Trial Model(Mobile Robot 4,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- Development and Control of a Buggy Robot for Operations on (2002) (0)
- 2P1-K01 A study on mechanism and control of bending and expanding Active Cord Mechanism : Slime model 1 (2007) (0)
- [Endothelin receptors]. (1992) (0)
- 2A2-H03 Development of the Crawler Robot for Detection/Search Type Anti-Disaster Measures : Development of the cable control method for the cable control robot (2007) (0)
- Introduction ofMission Unit onInformation Collection byOn-Rubble Mobile Platforms ofDevelopment ofRescue RobotSystems (DDI)Project inJapan (2006) (0)
- 2A2-V03 Extended Normalized Energy Stability Margin(Walking Robot (2)) (2012) (0)
- 1P1-O06 Development of wall climbing robot equipped with magnet units which can adjust their adhesive force depending on wall surface(Mobile Manipulation Robot) (2011) (0)
- 2A2-F08 Development of tidal power generator for seismograph and tsunami sensor at seabed : Proposal of double-cone shroud which has current acceleration effect(Underwater Robot and Mechatronics(1)) (2012) (0)
- 2P1-Q05 Development of a Water Jet Probe for inspection in difficult access areas (2015) (0)
- Simple Room Shape Modeling with Sparse 3d Point Information Using Photogrammetry and Application Software (2012) (0)
- 1P1-F4 Development of the New Motor Driver and Introduction of the Products in Collaboration (2001) (0)
- SUBCELLULAR LOCALIZATION OF PRORENIN IN THE HOG KIDNEY EXAMINED BY DENSITY-GRADIENT CENTRIEUGATION (1982) (0)
- Boric acid transport activity of marine teleost aquaporins expressed in Xenopus oocytes (2023) (0)
- 2P1-L16 Development of Snake-like Robot "ACM-R4n" with Joint Torque Measurement System and Limiter(Bio-Mimetics and Bio-Mechatronics) (2011) (0)
- Study on Articulated Mobile Robot Introduction and Experiment in Perspective Control (2003) (0)
- 1A1-R12 Development of manipulator "ZAHN Arm" for mounting the mobile robot : No.1: Study on the "Camera Arm"(Robotics for Hazardous Fields) (2013) (0)
- Underwater observation apparatus (2014) (0)
- Development of "HELIX" : Application of A Novel Helical Distortion Swimming Principle (2002) (0)
- Omni-directional mobile robot with step-climbing capability: "VmaxCarrier2" (2004) (0)
- Development of Quadruped Walking Robot "TITAN-IX" with work functions : Optimized design of control and drive system and Basic experiments (2002) (0)
- COBALT VARIANT OF THE RAINBOW TROUT Oncorhynchus mykiss : REMARKABLE STORAGE OF ABDOMINAL FAT AND HYPOTHALAMIC DIFFERENCE (1999) (0)
- Purification and Properties of Bovine Pituitary Renin (1982) (0)
- Subject Index Vol. 9, 2001 (2001) (0)
- Study on Ankle Mechanism for Walking Robots : Develoopment of 2 D. O. F. Coupled Drive Ankle Mechanism (2004) (0)
- 1A2-P20 Development of a Coupled Tendon-Driven Multi-joint Manipulator for Decommissioning Nuclear Power Plant : Introduction of mini CT-Arm model with 3D joint mechanism(Mechanism and Control for Wire Actuation System) (2013) (0)
- [Shared equipments in facilities for common use]. (2004) (0)
- 1A1-N10 Design of an adaptive under-actuated gripper for the arm-equipped tracked vehicle HELIOS VIII (2007) (0)
- Development of Surface Wave Mechanism: Proposition of the Concept and Experiment of Prototypes (2014) (0)
- Development of Quadruped Jumping Robot Driven by Pneumatic Actuators (2003) (0)
- 1A1-A4 Study on Slim Slime Robot : Development of Slim Slime Robot and Implemtation of its 3D Gait (2001) (0)
- 1P1-A5 Development of "Genbu" : multi bodies and multi wheels mobile robot (2001) (0)
- Direct Radioimmunoassay of Renin and Its Application : THE 10th CONFERENCE ON THE PATHOGENESIS OF HYPERTENSION (1981) (0)
- Rapid and Large-Scale Purification of Angiotensin-I Forming Enzymes and Milk Clotting Enzymes by Affinity Chromatography (1982) (0)
- [Radioluminography and scintillation proximity assay for high-throughput screening]. (2004) (0)
- DEVELOPMENT OF BRIDGE INSPECTION ROBOT SYSTEM SUSPENDED BY WIRES (2020) (0)
- Development of a Light Duty Hand-Arm System: (2011) (0)
- Autocrine Regulation of Rat Chondrocyte Proliferation (2001) (0)
- TITAN-XIII: sprawling-type quadruped robot with ability of fast and energy-efficient walking (2016) (0)
- Development of Unicorn Reel: Hermetic traction-controllable cable reel with passive-lever level winder (2014) (0)
- 2A1-M3 Research On Hyper-Tether : No.10 Autonomous Control of an Engine Driven Mobile Platform (2001) (0)
- The Study of Map Realization System (1988) (0)
- 1A2-G02 Improvement of Metal Detecting Performance for Humanitarian Demining (2009) (0)
- Study of Map Realization System : Recognition of Known Objects, Estimation of Invisible Area and Localization of Mobile Robot Using Shape Matrix Method (2002) (0)
- Existence of lipid vesicles containing platelet-activating factor in endothelial cell lysate (1992) (0)
- - exchange activities of zebrafish NHE 3 b expressed in Xenopus oocytes (2013) (0)
- High water intake compensates for the capacity to excrete a normal potassium load in dominant negative Kir7.1 transgenic mice. (2006) (0)
- Robotics as a Popular Engineering (2003) (0)
- 2A2-A06 Research of improving the finger's sensitivity by pressing with the lugs : Basic consideration of the experimental conditions(Tactile and Force Sensing (2)) (2013) (0)
- Development of "Souryu-IU":&nnected Crawler Vehicle for Inspecbon inside Narrow and Win- Spaces (2004) (0)
- Development of Brand-new Portable Earthquake Simulator Using Holonomic Omni-directional Platform (2011) (0)
- Gene Expression of Vascular Natriutretic Peptide Receptor Type A is Upregulated in Hypertensive Rats (1996) (0)
- The omni directional vehicle moved on the wall (2002) (0)
- The mechanism of local blood acidification in the swimbladder by spatially organized monocarboxylate transporters (2012) (0)
- Study on the Bent Pneumatic Actuator : Design optimizaation and Feasibility analysis (2004) (0)
- 2P1-R02 Development of a Track-changeable Quadruped Walking Robot, TITAN X : 4th Report: Experiments of Climbing Up Steps by Hybrid Form for Track and Legs (2015) (0)
- Endothelins inhibit the mineralization of osteoblastic MC3T3-E1 cells through the A-type endothelin receptor. (1998) (0)
- Study of Shape Representation Using Internal Radiated-light Projection (2002) (0)
- [Prorenin in hog kidney: occurrence and characterization (author's transl)]. (1980) (0)
- Enhanced expression and secretion of C-type natriuretic peptide by the heart of freshwater eels(Endocrinology)Proceedings of the Seventy-First Annual Meeting of the Zoological Society of Japan (2000) (0)
- General systems group report (1996) (0)
- 2P1-B15 Development of a Quadruped Walking Robot to Work on Slopes, TITAN XI : 10th report: Operation on Real Construction Site (2008) (0)
- 2A2-M02 Development of neutral buoyancy arm "Neutra-I" for underwater inspection in nuclear power plants(Underwater Robot and Mechatronics) (2013) (0)
- Title Identification of SAMT family proteins as substrates of MARCH 11 in mouse spermatids (2017) (0)
- Development of Far-Reach Tethered Working Tool between Mobile Platforms: -2nd Report: Construction of the Movement Control System and Verification Experiment-@@@―第2報：移動制御システムの構築と検証実験― (2016) (0)
- Editorial: Promoting Intellectual Sports (1998) (0)
- [0023] Electro-clinical characteristics of juvenile myoclonic epilepsy (JME) initially misdiagnosed and treated as focal epilepsy (2013) (0)
- 2P2-2F-A3 HELIOS VII : A New Hand Crawler Hybrid Vehicle (2003) (0)
- Study on Ankle Mechanism for Walking Robots : Development of Terrain Adaptive Passive Ankle Mechanism (2004) (0)
- Development of a practical landmine searching robot (2007) (0)
- 1P2-A07 Cable Tension Control for "Oscillating Level Winder Arm" (2015) (0)
- Proposal and basic experiments of a piping inspection system based on water-jet (2016) (0)
- A novel extracellular transglutaminase activity regulates the germination of Malus domestica pollen (2004) (0)
- 2A2-N09 Development of Lightweight Quadruped Robot TITAN-XIII : 2nd report: Fast Walking with Considering an Acceleration and a Deceleration (2015) (0)
- Functional characterization & physiology of NBCe1 from a marine teleost (2006) (0)
- IEEE ROBIO 2010 Conference Committees (2010) (0)
- Project-Based Learning in Engineering through Street Performance Robot Contest (2013) (0)
- Pufferfish Slc26a5 (prestin) exchanges Cl− for oxalate, sulfate, and bicarbonate (2010) (0)
- SIMPLE ROOM SHAPE MODELING WITH SPARSE 3 D POINT INFORMATION USING PHOTOGRAMMETRY AND APPLICATION (2012) (0)
- distribution, localization, and function in gills NHE3 in an ancestral vertebrate: primary sequence, (2005) (0)
- SOLUBILIZATION AND CHARACTERIZATION OF ACTIVE ANGIOTENSIN II RECEPTORS FROM THE BOVINE ADRENAL CORTEX (0)
- Title Study on a Practical Robotic Follower to Support Home Oxygen Therapy Patients-Development and Control of a Mobile Platform-Author (2019) (0)
- A NIQSDIGASENSDGDM VVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEG SCISGFQGMNLPTESGELWILGNVFIRQYFTVFDRANNQVGLAPVA bChy L NIQQAIGATQNQYGEF DIDCDNLSYMPTVVFEINGKMYPLTPSAYTSQDQG FCTSGFQSEN HS QKWILGDVFIREYYSVFDRANNLVGLAKAI Pen SQYYSQVSGAQQDSNAGGYVFDCSSS LPDFSVSISGYTATVPGSLINYGPSGDG STCLGGIQSNSG IG FSIFGDIFLKSQYVVFD (0)
- 1P2-F10 Research of Swing-Grouser that has High Step Climbability in Low Friction Environment (2015) (0)
- Mechanism and Control of Genbu : Active-Wheel Passive-Joint (AW-PJ) Articulated Mobile Robot : 2nd Report : Stack avoidance of active-wheel passive-joint articulated mobile robot (2003) (0)
- 1A2-M12 Development of Searching-Assist System for Tether-type Underwater Rescue Robot Anchor Diver III(Underwater Robot and Mechatronics) (2011) (0)
- [Mechanism of maintaining body fluid and ion homeostasis in fish]. (2012) (0)
- 2P1-A05 Development of unified pneumatic pillars and pedal-pump for rescue operation (2008) (0)
- Dustproof and waterproof machanism for design of HELIOS VII (2004) (0)
- Creativity Education and Street Artist Robot Contest (1994) (0)
- Structure of angiotensin II-binding site probed with diaminoalkanes. (1984) (0)
- 2A2-G03 Development of Detachable End-effector for Humanitarian Demining Robot "Gryphon" (2007) (0)
- Selected abstracts from the 14th annual meeting of the Japanese Societies of Hypertension. (1992) (0)
- [Isorenin--renin-angiotensin system of the brain]. (1982) (0)
- 1A1-E09 Development of Active-Deformable Sole for Terrain-Adaptive Quadruped Walking Robot (2008) (0)
- P25-6 EEG and VEP findings of acute confusional migraine in children (2010) (0)
- 2A1-N-036 Development of Actuator Unit for Operation Under Extreme Environmental Conditions : Basic Concept and Evaluation of the Primary Prototype(SMRJ Project-Development of Robot Components,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- REGULATION OF NA^+, K^+-ATPASE ACTIVITY IN EEL GILLS BY THE NATRIURETIC PEPTIDE(NP)SYSTEM AND THE RENIN-ANGLOTENSIN(ANG)SYSTEM (1998) (0)
- MARCH7 E3 ubiquitin ligase is highly expressed in developing spermatids of rats and its possible involvement in head and tail formation (2012) (0)
- High molecular weight renins in spontaneously hypertensive rat and stroke-prone spontaneously hypertensive rat [proceedings]. (1977) (0)
- Development of Novel Master-Slave Arm with Shape Feedback Unilateral-Servo Mechanism (2002) (0)
- 1A1-P03 Non-Tumbling Gait and Safety of Multi-legged Locomotion(Walking Robot (1)) (2013) (0)
- 2A1-A04 Development of Tether Mooring Type Submarine Robot (2008) (0)
- 1P1-A27 Development of Hyper-Redundant Arm with Weight Compensation and Braking Mechanisms (2006) (0)
- Position and Force Sensor based on Photodetecting Technology (1991) (0)
- Inhibition of transglutaminase activity prevents pollen tube growth in fruit species: is transglutaminase a molecular target of self-incompatibility?. (2004) (0)
- 2A2-G04 Development of demining robot "Gryphon" : Development of marking system (2007) (0)
- 2P1-H07 Proposal of Reel Mechanism for Avoiding Tether-stuck on Spool : Winding Motion Using Differential Mechanism with Planetary Gear Unit (2009) (0)
- Identification of a new member of the natriuretic peptide receptor and determination of the ligand binding domain and disulfide bonding patterns of the family members (1994) (0)
- 1A1-E21 Research on the slop walk of the quadruped walking robot (2008) (0)
- Design of Biologically Inspired Intelligent Mobile Robots (1996) (0)
- EFFECT of DOUBLE PARTIAL HEPATECTOMIES AT VARIOUS INTERVALS ON [3H]THYMIDINE INCORPORATION INTO RAT LIVER DNA (1978) (0)
- 1A2-G13 Development of unified pneumatic pillars for rescue operation : The 3rd report : Improvement of pillars and these controller for practical use (2009) (0)
- 1A2-K12 The development of transformable 3-wheeled lunar rover Tn-Star IV(Space Robotics and Mecahtoronics) (2011) (0)
- 2A1-P08 Development of Armrest Joystick : Design and Development of the 3DOF Posture Controller(Search and Rescue Robot and Mechatronics(1)) (2012) (0)
- Congenital Heart Diseases and Biotechnology: Connecting by Connexin (2014) (0)
- 1A1-R09 Development of CrankWheel robot equipped with Expansion Boom : Examination of the bending crank-leg and high rigidity boom(Robotics for Hazardous Fields) (2013) (0)
- 鉄道土木構造物の状態監視における無線センサネットワークの総費用最小化設計;鉄道土木構造物の状態監視における無線センサネットワークの総費用最小化設計;Minimization of the Total Cost of Wireless Sensor Networks for Railway Structural Monitoring (2013) (0)
- Operational quadrature time-domain boundary element method in 3-D scalar wave and elastic wave problems (2007) (0)
- FORWARD AND INVERSE ANALYSIS OF INCIDENT FIELD FROM A CONTACT ULTRASONIC TRANSDUCER (2002) (0)
- Accelerated ultrasonic imaging technique by GPGPU for nondestructive testing of structural concrete components * (2013) (0)
- 2A1-B03 Development of a Quadruped Walking Robot to Work on Slopes, TITAN XI : 7th report : Walking Motion on a Undulated Slope Model (2006) (0)
- DEVELOPMENT OF A FREQUENCY-DOMAIN BOUNDARY ELEMENT METHOD FOR 3-D POROELASTODYNAMICS IN GENERAL ANISOTROPY (2015) (0)
- Enriched finite element analysis of generalized dynamic fracture parameters in non-homogeneous piezoelectric solids (2014) (0)
- Development of Dinosaur-like Robot TITRUS : The motion utilizing the dynamic effect of the neck and tail (2003) (0)
- New Boundary Element Method Using the Laplace-Domain Fundamental Solutions and Its Application to 2-D Transient Wave Propagation Problems (2012) (0)
- A Study on Stability of an Inverse Problem to Estimate Vibration Mode of Immersion Ultrasonic Transducers (2001) (0)
- Fast multipole boundary element method for elastic wave scattering in 2-D anisotropic solids (2015) (0)
- Convolution Quadrature Time-Domain Boundary Element Method for Two-Dimensional Elastic Wave Propagation in General Anisotropy (2012) (0)
- On Further Popularization of the Robot Grand Prix (2002) (0)
- 62nd Japan National Congress for Theoretical and Applied Mechanics, 2013 (2013) (0)
- Application of Fast Multipole Boundary Element Method to Scattering Analysis of SH Waves by a Lap Joint (2003) (0)
- Proc.11th Symp.Ultrasonic Electronics, Kyoto, 1990 (1991) (0)
- Numerical simulation of nonlinear ultrasonic waves for bi-material interface evaluation * (2013) (0)
- 2-D SIMULATION OF SUB-HARMONIC GENERATION DUE TO CRACKS WITH CONTACT-BOUNDARY CONDITIONS (2015) (0)
- Experimental Validation of the Three Dimensional Inverse Scattering Imaging Method and Attempt of Enhancement of Signal-Noise Ratio by Delayed Excitations with Multi-elements (2013) (0)
- Scattering Analysis of Lamb Waves in a Perpendicularly Bent Plate (2005) (0)
- 1505 Large scale analysis of wave scattering in Biot material using convolution quadrature boundary element method (2012) (0)
- Modulation of Bleustein-Gulyaev Waves in a Functionally Graded Piezoelectric Substrate by a Finite-thickness Metal Waveguide Layer (2009) (0)
- VERIFICATION OF INVERSE SCATTERING IMAGING METHOD BY ULTRASONIC MEASUREMENT WITH ELECTRONIC SCAN DEVICE (2009) (0)
- A New Realization on Electro-Elastic Love Waves In Piezoelectric Layered Solids (2011) (0)
- OS0715 3D Numerical Simulation for Air-Coupled Ultrasonic Testing (2012) (0)
- Application of Memory‐Saved Time Domain BIE Method for Visualization of Scattered Wave Fields (2005) (0)
- Development of frequency-domain boundary element method for wave scattering in anisotropic fluid-saturated porous media (2014) (0)
- Development of Small Arm Equipped Single Wheel Rover : Systematization with a mother unit (2002) (0)
- Crank Tether Thruster : A Thruster Mechanism for Teleoparated Robots (2016) (0)
- Development of a Quadruped Walking Robot to Work on the Slope "TITAN XI" (2003) (0)
- P25-9 Application of motor nerve conduction study in spinal cord diseases of children (2010) (0)
- Simulation for ultrasonic evaluation of a welding defect in a thick plate (2000) (0)
- FLAW SHAPE RECONSTRUCTION USING TOPOLOGICAL GRADIENT FOR 2D SCALAR WAVE EQUATION (2008) (0)
- 177 Analysis of elastic wave scattering by crack with contact boundary conditions in anisotropic solids (2015) (0)
- Study of Shape Representation Using Internal Radiated-light Projection Method (2003) (0)
- Integral Equation Methods to Dynamic Analysis of Anisotropic Surface Inhomogeneities (1988) (0)
- FORWARD AND INVERSE SCATTERING ANALYSIS FOR DEFECT IN ANISOTROPIC PLATE USING CONVOLUTION QUADRATURE TIME-DOMAIN BOUNDARY ELEMENT METHOD (2016) (0)
- DEVELOPMENT OF A DE-SINC BEM AND ITS APPLICATION TO 2D ANTIPLANE WAVE PROBLEMS (2018) (0)
- Damage assessment of steel plates bonded onto concrete slabs by laser technique (2015) (0)
- A Modeling of Immersion Ultrasonic Testing and Simulation of Scattered Wave from Flaws (2004) (0)
- CHANGES OF ULTRASONIC VELOCITIES IN THE THICKNESS DIRECTION OF ANISOTROPIC ROLLED STEEL PLATE (2002) (0)
- Detection of Water Ponding State on Steel Plate Using Guided Waves (2018) (0)
- ULTRASONIC SCATTERING ANALYSIS TO CHARACTERIZE NONLINEAR BEHAVIOR OF MATERIAL INTERFACES (1992) (0)
- Identification of Vibration Characteristics of an Immersion Transducer (2000) (0)
- 2007 Development of fast and efficient CQ-BEM methodology and its application to wave propagation problems (2013) (0)
- Dynamic fracture of star cracks (1993) (0)
- A time-domain modeling of SH-wave ultrasonic linear array transducers (2006) (0)
- 360411 3-D ANALYSIS OF THE INFLUENCE OF A PILE ON UNDERGROUND INDUCED VIBRATIONS USING THE BOUNDARY ELEMENT METHOD(Infrastructure,Technical Session) (2009) (0)
- Transverse surface waves in piezoelectric ceramic/metal coupled media (2009) (0)
- How to Draw out the Robot from Factory (1990) (0)
- Development of automatic non-destructive evaluation system using transfer learning for wave field data (2020) (0)
- 2-D inverse scattering analysis for a defect in authentic stainless steels (2017) (0)
- Inverse Scattering Analysis for Cavities in Anisotropic Solid (2003) (0)
- Scattering Characteristics by Various Defects in Anisotropic Materials (1999) (0)
- 3-D Numerical Simulation of Nonlinear Ultrasonic Testing Using CQ-BEM (2014) (0)
- ESTIMATION OF WATER PONDING ON STEEL PLATE ATTACHED TO THE BOTTOM SURFACE OF REINFORCED CONCRETE SLAB OF HIGHWAY BRIDGES (2020) (0)
- Application of memory-saved time domain BEM to simulation of ultrasonic wave propagation (2004) (0)
- Effect of material anisotropy on angle beam ultrasonic testing (2001) (0)
- Study of Articulated Body Mobile Robot (Introduction and Experiment of Perspective Control) (1992) (0)
- 216 A combined method of convolution quadrature time-domain Galerkin BEM and FEM for 2-D wave propagation (2015) (0)
- Scattering Analysis of Torsional Wave in a Rod with a Notch (2003) (0)
- Application of fast multipole boundary element method to scattering analysis of SH Lamb waves by lap joint (2003) (0)
- J0420204 Evaluation of Steel Plate Bonding Using Laser Based Method (2014) (0)
- Development of a method to estimate one-dimensional distribution of dielectric constant using electromagnetic waves (2017) (0)
- 1P1-N-046 Teleoperated Buggy Vehicle and Weight Balanced Arm System for Mechanization of Mine Detection Tasks : System Integration and Field Evaluation Tests(Mobile Manipulation Robot 2,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- A LARGE SCALE ANALYSIS FOR ULTRASONIC WAVE PROPAGATION USING PARALLELIZED FDTD METHOD (2008) (0)
- 550 CQ-BEM using FMM in 2-D viscoelastodynamics (2008) (0)
- Development of an actuation system based on water jet propulsion for a slim long-reach robot (2017) (0)
- Quantitative non-destructive evaluation of damages in a steel plate bonding method (2014) (0)
- Keynote:Convolution Quadrature BEM for Wave Analysis in General Anisotropic Fluid-Saturated Porous Solid and its GPU Acceleration (2014) (0)
- SH WAVE SCATTERlNG BY A DEFECT IN A PLATE (2012) (0)
- A Coupling Method of Boundary Element Method and Generalized Ray Theory for Elastic Wave Scattering in a Thick Plate (2003) (0)
- Air-Coupled Ultrasonic Non-destructive Test in Single-Reinforced Concrete (2016) (0)
- 3-D analysis of wave propagation in micropolar elastic solids using FDTD method (2020) (0)
- Coup led Tendon - driven (1991) (0)
- A 3D LINEARIZED INVERSE SCATTERING METHOD FOR SCATTERERS IN A TWO LAYERED MEDIUM (2002) (0)
- Elastic wave scattering by various defects in anisotropic materials (2000) (0)
- Development of Inverse Scattering Imaging Technique for Linearly Arrayed Ultrasonic Transducer (2006) (0)
- Application of Inverse Scattering Method to Ultrasonic Testing using Phased Array Transducer (2007) (0)
- Three dimensional analysis of groung motion by integral equation method in wave number domain (1985) (0)
- 2P1-C03 Mechanism and Control of Wall Climbing Robot with Tethered Jumping Motion (2008) (0)
- Time-domain isogeometric boundary element method based on the convolution quadrature method for scalar wave propagation (2017) (0)
- Special Issue on Key Technology of Miniaturization. Compact and Light-weight Design of Robot Mechanism. (1994) (0)
- 2P1-E18 Design of Falcon : three-wheeled vehicle with high-mobility over uneven terrain (2009) (0)
- A Combined Method of Far-field Approximation and Boundary Integral Equation for Cylindrical Wave Scattering (1998) (0)
- PROPOSITION OF A BUCKLING EXPERIMENT WITH STEEL FOR EDUCATION (2020) (0)
- Machine Design in the Mechatronics Age (1989) (0)
- P27-11 Neural basis of abnormal face perception at a preattentive level in autism spectrum disorders (2010) (0)
- For the Special Issue on "Phased Array Ultrasonic Testing" (2013) (0)
- Applications of approximate wave analysis to ultrasonic flaw imaging (2013) (0)
- APPLICATION OF MODE EXCITING METHOD COMBINED WITH PARTIAL ANALYSIS METHOD TO SCATTERING ANALYSIS OF LAMB WAVES IN PLATE (2002) (0)
- Ultrasonic imaging of concrete using Wavelet transform and Hilbert-Huang transform as signal processing tools (2010) (0)
- Development of crawler unit equipped with dustproof and waterproof mechanism for rescue robot (2004) (0)
- Analysis and Experiment on the Scattering of Guided Waves in 3-D Plates (2007) (0)
- Development of the coupling method of a 2.5-D boundary element method and a 3-D fast multipole boundary element method for environmental vibration analysis (2004) (0)
- Multiple Scattering of Inplane Wave in Matrix-Inclusion Medium (2004) (0)
- 1P2-S-017 Basic Evalution of Leg-Wheel Hybrid Mobile Vehicle Zero Carrier(Mobile Robot 2,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- 3-D Analysis of Guided Wave Reflection by an Edge in a Plate (2006) (0)
- A simulation study on defect shape reconstruction ability of synthetic aperture focusing technique (2004) (0)
- Multiple scattering analysis of elastic waves using fast multipole boundary element method (2005) (0)
- Ultrasonic Inversion for Determining Crack Size in a Solid (1997) (0)
- MODEL STUDIES ON SCATTERING OF ELASTIC WAVES IN A HALF SPACE (1986) (0)
- Transient dynamic crack analysis in multifield coupled smart functional materials by XFEM (2014) (0)
- Semi-analytical modeling of acoustic beam divergence in homogeneous anisotropic half-spaces. (2016) (0)
- Forward and Inverse Researches on Scattering of Ultrasonic Surface Waves by Near-Surface (2018) (0)
- 602 Simulation of electromagnetic acoustic transducer using the convolution quadrature based BEM (2011) (0)
- Numerical Simulation of Nonlinear Ultrasonic Wave Generation by an Interface Crack of Bi-material (2014) (0)
- J0406-2-1 Simulation of ultrasonic wave propagation in dissimilar metal welding part with image based EFIT (2009) (0)
- The Consequences of Material Nonlinearity on the Axisymmetric Flexural Vibration Measurements for Estimating the Dynamic Elastic Modulus of Damaged Cement Based Materials (2016) (0)
- 2258 Development of flaw shape imaging method using ultrasonic linear array transducer (2005) (0)
- EDGE-REFLECTION ANALYSIS OF GUIDED WAVES IN A 3-D PLATE (2006) (0)
- Reflection and Scattering of a Cylindrical Wave in a Half Space (1999) (0)
- A Boundary Element Method For Wave Scattering In Fluid-saturated Porous Rocks (2015) (0)
- Scattering by a Penny-Shaped Crack Subject to Oblique Incident Waves (1992) (0)
- Large Scale Wave Analysis for Fluid-Saturated Porous Media Using Convolution Quadrature Boundary Element Method (2012) (0)
- Inverse shape reconstruction for thinning flaw of plates using ultrasonic guided waves * (2013) (0)
- Keynote: 2-D inverse scattering analysis using pure SH wave for delamination in carbon fiber reinforced plastic (2018) (0)
- Reflection and Scattering of a Cylindrical Wave by a Defect near a Free Surface (1998) (0)
- 1501 Two-dimensional wave scattering analysis by a crack in general anisotropic solids using convolution quadrature Galerkin boundary element metohd (2012) (0)
- Propagation of Thickness-Twist Waves in an Infinite Piezoelectric Plate (2010) (0)
- Scattering of Elastic Waves by Interface Cracks between Dissimilar Materials (1993) (0)
- 2011 Convolution quadrature boundary element method for 3D poroelastic wave propagation (2013) (0)
- 2A1-B10 Study of Map Realization System : Interpolation Method of Invisible Area using Terrain Database (2001) (0)
- Development of Convolution Quadrature Time-Domain Boundary Element Method for Fluid-Elastic Half Space and Its Application to Air-Coupled Ultrasonic Simulation (2011) (0)
- Biomechanical Study on Serpentine Locomotion The Kinematics of Gliding Movement in Labyrinth (1976) (0)
- Application of a Particle Filter to Flaw Identification for Ultrasonic Nondestructive Evaluation: Assimilation of Simulated and Measured Data (2021) (0)
- An Imaging Method of Reinforced Bar and Its Debonding Area using Ultrasonic Wave (2005) (0)
- Transient SH-wave simulation in a multilayered half-space with irregular interfaces based on a hybrid BEM (2010) (0)
- Modelling III An Investigation into Scattering Properties of Ultrasonic Waveguides in Pipes by Mode-exciting Method (2010) (0)
- 3-D NUMERICAL SIMULATION OF SUB-HARMONIC GENERATION PHENOMENON DUE TO CONTACT ACOUSTIC NONLINEARITY ON CRACK FACES (2016) (0)
- Ultrasonic Inspection for Structures (2018) (0)
- 2A1-S-059 Development of novel helicopter with steering type reaction-wings(Flying Robot 3,Mega-Integration in Robotics and Mechatronics to Assist Our Daily Lives) (2005) (0)
- Solid‐phase synthesis of human osteocalcin by using a γ‐carboxyglutamic acid derivative (2009) (0)
- United States Patent ( 19 ) Kurihara et al . ( 54 ) Y-CARBOXYGLUTAMATE DERIVATIVE , METHOD FOR PREPARING THE SAME AND METHOD FOR PREPARING (2017) (0)
- Solid-phase synthesis of human osteocalcin by using a gamma-carboxyglutamic acid derivative. (1994) (0)
- W-07 International Engineering and Science Research Exchange Program Enhancements through Innovations(International Session) (2015) (0)
- Assistance of Japanese Language for International Graduate Students of Science and Technology approaching to job hunting (2006) (0)
- Extraction of liquid organic multi-component mixture with ionic liquids as solvents (2007) (0)
- Development of Real-Time Stereo Vision with Multi-Arrayed Camera (1991) (0)
- Manufacturing Culture in Future Robotic Society (1996) (0)
- Salt Effects on Lower Critical Solution Temperature and Particle Size of Chitosan Derivative in Aqueous Solutions (2004) (0)
- Study on the extending motion of Bridle Bellows (2007) (0)
- 1A1-A3 Development of off-road Vehicle "HELIOS-VI" : Sequence of development and design of new mechanism (2001) (0)
- Lateral movement of Active Cord Mechanism (2004) (0)
- Nontumbling Gait for Multilegged Robots and Its Directional Normalized Energy Stability Margin (2013) (0)
- Message for Young Researchers (2011) (0)
- 2P1-K02 Development of the Camera Mechanism for 'Souryu-V' -The In-Rubble Research Robot Equiped with Crawlers on All its Surfaces (2007) (0)
- Structure and regulation of the gene encoding rat LOX-1 (1998) (0)
This paper list is powered by the following services:
Other Resources About Shigeo Hirose
What Schools Are Affiliated With Shigeo Hirose?
Shigeo Hirose is affiliated with the following schools:
